Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida glabrata Mitochondrial Intermembrane Space Import and Assembly Protein 40 (MIA40)

Mitochondrial intermembrane space import and assembly protein 40 (MIA40) is essential for importing and folding cysteine-containing proteins within the mitochondrial intermembrane space (IMS) . MIA40 acts as a receptor that binds incoming proteins via hydrophobic interactions, thus mediating protein translocation .

Functional Elements and Mechanism

MIA40 contains two functional elements :

  • An N-terminal cysteine-proline-cysteine motif that facilitates substrate oxidation.

  • A C-terminal hydrophobic pocket for substrate binding.

MIA40 primarily functions as a trans-site receptor in mitochondria, binding incoming proteins through hydrophobic interactions to mediate their translocation across the outer membrane . This process is facilitated by a 'holding trap' mechanism rather than a 'folding trap' . The substrate-binding domain of MIA40 is both necessary and sufficient to promote protein import, suggesting that trapping by MIA40 drives protein translocation .

Role in Protein Import and Oxidation

Many proteins in the mitochondrial IMS have conserved cysteines that are oxidized to disulfide bonds during import . MIA40 is essential for this oxidation and import process . Although Mia40 facilitates protein oxidation, this function is important after the translocation reaction, likely to fold IMS proteins into a functional and protease-resistant conformation .

Impact on Protein Levels

Overexpression of MIA40 can lead to higher cellular levels of MIA40 substrates, such as Atp23, Tim10, and Cmc1 . This suggests that endogenous MIA40 levels are rate-limiting under physiological conditions and that only a fraction of the MIA40 substrates initially synthesized in the cytosol accumulate as stable proteins in vivo .

Genetic Diversity and Microevolution

Candida glabrata exhibits genetic diversity that impacts virulence and drug resistance . Comparative genomic analysis reveals recombinant sequence types (STs), hypervariable mitochondrial genomes, and variation in virulence genes and drug targets .

Interaction with Apoptosis-Inducing Factor 1 (AIFM1)

MIA40 interacts with apoptosis-inducing factor 1 (AIFM1) to suppress AIFM1-induced cell death in a NADH-dependent manner . The N-terminal domain of MIA40 interacts with AIFM1, forming an extended β-sheet with AIFM1's C-terminal domain . MIA40 can stabilize the AIFM1 dimer and modulate the translocation of AIFM1 to the nucleus . Depletion of MIA40 sensitizes cells to AIFM1-induced cell death, indicating that MIA40 reduces AIFM1 activity through physical interaction and stabilization of the AIFM1 dimer .

Role in Complex I Biogenesis and Metabolic Stress

MIA40 is crucial for importing subunits of complex I, such as NDUFS5, NDUFB7, and NDUFA8 . The NADH/NAD+ balance, a metabolic sensor related to complex I impairment, can enhance AIFM1-MIA40 interaction to improve MIA40 pathway efficiency and recover complex I biogenesis . This interaction may prevent premature cell death upon complex I impairment and increased NADH/NAD+ balance .

Implications in Cancer

Complex I subunits may act as cancer suppressors, and mutations of complex I genes can result in tumorigenesis progression . MIA40's modulation of AIFM1-induced cell death could be relevant in cancers with high NADH/NAD+ ratios .

Biochemical Characteristics

Purified recombinant MIA40 migrates more slowly on SDS-PAGE than expected due to its highly acidic nature, which reduces SDS binding . MIA40 is selectively present in the mitochondrial fraction and largely released to the supernatant upon sonication . It is protected against protease treatment in intact mitochondria but degraded after opening the IMS space .

Subcellular Localization

MIA40 is located in the mitochondrial IMS . Fractionation of yeast cells demonstrates its presence in the mitochondrial fraction . Upon sonication of mitochondria, MIA40 is released to the supernatant, similar to IMS proteins .

Import Pathway

The precursor of MIA40 is processed in two steps and transported to a protease-protected location in a Δψ-dependent manner . The biogenesis of MIA40 shows characteristics typical of proteins with a bipartite presequence .

MIA40 in Saccharomyces cerevisiae

Studies in Saccharomyces cerevisiae have contributed to understanding MIA40's role in protein import into the mitochondrial intermembrane space . Research shows that the ability of MIA40 to bind proteins, rather than its enzyme activity, is essential for importing proteins into the intermembrane space .

Candida glabrata MIA40 ELISA

ELISA kits are available for the detection of Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40(MIA40) .

Amino Acid Sequence and Characteristics

The amino acid sequence of Candida glabrata MIA40 is available, including details on expression region and sequence information .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIA40; TIM40; CAGL0D03520g; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-404
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
MIA40
Target Protein Sequence
SSKYAQESENAKRHKMGLLIAGVAVAGAIVFVTPPQWKKYFRAAKKVEEVAESKEDPVSE AAEEVSESVQESTEEPQQSQEKETADVGNEQAQDESASSGDSEAKKAHDEFADQNEASEK ESAPMGESADADQTAKDETVAEKTGNSKSESSESDQSEQDILSSDLEETMETVSEADKEL HQISDNTVLSSEEDKTPKAEELKSTSPSGNDEEPKKEDDSSKTIHSLNSEKDMEAVEEEV KQESAYNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSEAEPKGIDCVEKFQHMQD CFRRYPEHYAEQLADPADDENVDHEKNLSEGKDTGVDSTPPKDEAYLKTEKEKKIEENAS PDEDTASKKD
Uniprot No.

Target Background

Function

Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40) is essential for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, oxidizing the precursor and enabling it to form an intramolecular disulfide bond and subsequently fold correctly within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is MIA40 and what is its primary function in Candida glabrata?

MIA40 (Mitochondrial intermembrane space import and assembly protein 40) is an essential protein located in the mitochondrial intermembrane space (IMS) of Candida glabrata. It functions as a central component of the protein import and assembly machinery specific to the mitochondrial IMS. The primary role of MIA40 is to facilitate the translocation of nuclear-encoded precursor proteins across the outer mitochondrial membrane into the IMS and assist in their proper folding and assembly into functional complexes. MIA40 is particularly critical for the import of small IMS proteins, including the essential Tim9 and Tim10 proteins .

How does the structure of Candida glabrata MIA40 relate to its function?

Candida glabrata MIA40 is a full-length mature protein consisting of 370 amino acids (residues 35-404). Its amino acid sequence contains strategically positioned cysteine residues that are crucial for its oxidoreductase activity. The protein contains a conserved CPC (cysteine-proline-cysteine) motif and twin CX9C motifs that are essential for the formation of disulfide bonds with substrate proteins. This structural arrangement enables MIA40 to function as an oxidoreductase that facilitates the transfer of disulfide bonds to incoming precursor proteins, causing their oxidative folding and trapping them in the IMS .

How does MIA40 differ from other protein import machineries in mitochondria?

Unlike other mitochondrial protein import systems (TOM/TIM23/TIM22 for outer membrane, inner membrane, and matrix proteins), MIA40 represents the first identified component of an IMS-specific protein import machinery. While other import systems primarily rely on membrane potential or ATP hydrolysis, the MIA40 pathway utilizes a redox-driven mechanism. MIA40 functions through covalent disulfide bond formation with substrate proteins, which distinguishes it from the chaperone-based mechanisms employed by other import machineries. This unique mechanism is specifically adapted for the oxidizing environment of the IMS and enables the selective import and retention of cysteine-rich proteins in this compartment .

What are the optimal conditions for working with recombinant Candida glabrata MIA40 protein?

When working with recombinant Candida glabrata MIA40 protein, the following conditions are recommended for optimal results:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store at 4°C for up to one week for active work

  • For long-term storage, add 5-50% glycerol (50% is recommended) and store in aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein activity

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

Buffer conditions:

  • The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0

How can researchers assess the functional activity of recombinant MIA40?

To assess the functional activity of recombinant MIA40, researchers can employ several complementary approaches:

In vitro disulfide bond formation assay:

  • Incubate purified recombinant MIA40 with reduced substrate proteins containing free thiols

  • Monitor disulfide bond formation using non-reducing SDS-PAGE to detect mobility shifts

  • Quantify the oxidized versus reduced forms of the substrate protein over time

Import assays with isolated mitochondria:

  • Prepare radiolabeled precursor proteins of known MIA40 substrates (e.g., Tim9, Tim10)

  • Incubate with isolated mitochondria containing either wild-type or mutant MIA40

  • Analyze protein import efficiency by SDS-PAGE and autoradiography

  • Compare import rates between wild-type and mutant conditions to assess MIA40 functionality

Interaction studies:

  • Perform blue native polyacrylamide gel electrophoresis (BN-PAGE) to detect MIA40-substrate intermediates

  • Confirm interactions using antibody-shift assays with anti-MIA40 antibodies

  • Conduct crosslinking experiments with the oxidizing reagent CuCl₂ to stabilize disulfide-linked intermediates

What experimental systems are most suitable for studying MIA40 function in Candida glabrata?

Several experimental systems have proven effective for studying MIA40 function in fungal species, which can be adapted for Candida glabrata:

Isolated mitochondria system:

  • Isolate intact mitochondria from Candida glabrata cells

  • Incubate with radiolabeled precursor proteins

  • Analyze import and assembly of proteins into the IMS

  • This system allows direct assessment of MIA40 function in its native environment

Conditional mutant strains:

  • Generate temperature-sensitive mutants (e.g., mia40-3, mia40-4)

  • Compare protein import at permissive versus non-permissive temperatures

  • This approach enables the study of MIA40 in vivo while avoiding lethality issues

Recombinant protein system:

  • Express and purify recombinant MIA40 and substrate proteins

  • Perform in vitro reconstitution of the oxidative folding pathway

  • This system allows detailed biochemical characterization under controlled conditions

Heterologous expression system:

  • Express Candida glabrata MIA40 in E. coli for structure-function studies

  • This approach facilitates the production of sufficient protein quantities for structural and biochemical analyses

How does MIA40 recognize and interact with its substrate proteins?

MIA40 recognizes and interacts with its substrate proteins through a multi-step process:

  • Recognition of IMS-targeting signals: MIA40 recognizes specific internal targeting signals within substrate proteins, often characterized by cysteine residues arranged in conserved motifs (CX₃C or CX₉C patterns).

  • Formation of mixed disulfide intermediates: Upon substrate binding, MIA40 forms a transient disulfide bond with the substrate protein via its active-site CPC motif. This covalent interaction is crucial for substrate recognition and represents the initial step in the import process.

  • Hydrophobic interactions: In addition to disulfide bond formation, MIA40 also binds substrates through non-covalent hydrophobic interactions. This dual binding mode (covalent and non-covalent) is particularly evident in the case of Tim22, where MIA40 binds the precursor protein via both mechanisms .

  • Substrate specificity: MIA40 exhibits specificity toward proteins containing particular cysteine motifs, including small Tim proteins (Tim9, Tim10, Tim13) and Cox proteins (Cox17, Cox19) involved in respiratory chain assembly .

What is the mechanistic role of MIA40 in the oxidative folding pathway?

MIA40 plays a central mechanistic role in the oxidative folding pathway within the mitochondrial IMS:

  • Receptor function: MIA40 acts as a receptor for incoming precursor proteins, capturing them as they emerge from the TOM complex into the IMS.

  • Oxidoreductase activity: As an oxidoreductase, MIA40 introduces disulfide bonds into substrate proteins. The catalytic CPC motif of MIA40 transfers a disulfide bond to the substrate protein, resulting in the reduction of MIA40 itself.

  • Folding catalyst: Beyond simply introducing disulfide bonds, MIA40 promotes the correct folding of substrate proteins by guiding the formation of the native disulfide bond pattern.

  • Cooperation with Erv1: MIA40 functions in concert with the sulfhydryl oxidase Erv1. After transferring disulfide bonds to substrate proteins, MIA40 is reoxidized by Erv1, which in turn transfers electrons to cytochrome c and ultimately to the respiratory chain, completing the electron transfer system.

  • Import facilitator: The oxidative folding induced by MIA40 prevents backsliding of imported proteins to the cytosol by conferring a folded structure that cannot pass back through the TOM complex, thus trapping proteins in the IMS .

How does the MIA40 pathway integrate with other mitochondrial import pathways?

The MIA40 pathway shows significant integration with other mitochondrial import pathways:

  • Cooperation with the TOM complex: All mitochondrial proteins, including MIA40 substrates, initially enter through the TOM (Translocase of the Outer Membrane) complex. MIA40 receives its substrates as they emerge from the TOM channel into the IMS.

  • Functional overlap with the TIM22 pathway: MIA40 not only imports IMS proteins but also participates in the biogenesis of inner membrane proteins. Notably, MIA40 facilitates the import and assembly of Tim22, a core component of the TIM22 translocase responsible for inserting carrier proteins into the inner membrane. This represents a previously unrecognized functional overlap between the MIA40 and TIM22 pathways .

  • Indirect influence on matrix protein import: By ensuring the proper assembly of small Tim proteins (Tim9, Tim10), which function as chaperones for carrier proteins in the IMS, MIA40 indirectly supports the TIM22-mediated import of metabolite carriers to the inner membrane.

  • Redox connection to respiratory chain: The MIA40-Erv1 disulfide relay system connects to the respiratory chain through electron transfer to cytochrome c, linking protein import to mitochondrial energy metabolism .

How does Candida glabrata MIA40 compare to its homologs in other species?

Comparative analysis of MIA40 across different species reveals both conserved and divergent features:

FeatureCandida glabrata MIA40Saccharomyces cerevisiae MIA40Mammalian MIA40
Gene NameMIA40/TIM40YKL195wCHCHD4
Size370 aa (mature form, 35-404)~403 aa~16 kDa (much smaller)
LocalizationMitochondrial IMSMitochondrial IMSMitochondrial IMS
EssentialYesYesYes
Key MotifsCPC and twin CX₉C motifsCPC and twin CX₉C motifsCPC and twin CX₉C motifs
Membrane AssociationN-terminal region anchors to inner membraneN-terminal region anchors to inner membraneSoluble protein without membrane anchor
Known SubstratesTim9, Tim10, Tim13, Tim22Tim9, Tim10, Tim13, Tim22, Cox17, Cox19NDUFA8, COX17, COA6, TIMM10, TIMM13

While the core functional domains and mechanisms are conserved across species, there are notable differences in size, membrane association, and potentially in substrate specificity. The conservation of the CPC and twin CX₉C motifs across species highlights their fundamental importance to MIA40 function .

What is known about the evolutionary conservation of the MIA40 pathway?

The MIA40 pathway shows significant evolutionary conservation across eukaryotes, but with some notable adaptations:

  • Core components conservation: The core components of the MIA40 pathway (MIA40 and Erv1/ALR) are conserved from fungi to mammals, indicating the fundamental importance of this disulfide relay system for mitochondrial function.

  • Structural adaptations: While the functional domains are conserved, structural adaptations have occurred. Mammalian MIA40 (CHCHD4) is considerably smaller than its fungal counterparts and lacks the N-terminal membrane anchor present in yeast MIA40s.

  • Expanded substrate repertoire: The MIA40 pathway has expanded its substrate repertoire during evolution. In addition to small Tim proteins and Cox proteins, mammalian MIA40 targets components of respiratory chain complexes and other mitochondrial proteins not recognized by fungal MIA40.

  • Recruitment of additional factors: Higher eukaryotes have recruited additional factors into the MIA40 pathway, including glutathione and the cytosolic thioredoxin system, which provide reducing power and may enhance the efficiency and regulation of the pathway.

  • Connection to pathology: In higher eukaryotes, the MIA40 pathway has been implicated in various pathological conditions, including cancer and neurodegenerative diseases, highlighting its evolved importance in complex multicellular organisms .

How does MIA40 function relate to Candida glabrata pathogenicity?

While direct evidence linking MIA40 function to Candida glabrata pathogenicity is limited, several indirect connections can be drawn:

  • Essential for mitochondrial function: MIA40 is essential for proper mitochondrial function through its role in importing critical IMS proteins. Mitochondrial function is known to influence virulence traits in fungal pathogens, including stress resistance and metabolic adaptation to host environments.

  • Stress response and adaptation: Proper mitochondrial function is crucial for cellular responses to oxidative stress encountered during host immune attacks. By ensuring the correct assembly of respiratory chain components, MIA40 may contribute to the pathogen's ability to withstand host-derived oxidative stress.

  • Metabolic flexibility: C. glabrata is known for its adaptability to different nutrient conditions within the host. Mitochondrial proteins imported via the MIA40 pathway are involved in various metabolic processes, potentially supporting the metabolic flexibility required for successful host colonization and infection.

  • Unique features in C. glabrata: As a haploid organism with distinctive pathogenic traits compared to other Candida species, C. glabrata may have evolved specific adaptations in its MIA40 pathway to support its particular lifestyle as both a commensal and opportunistic pathogen. C. glabrata is known for its innate resistance to azole antifungals and ability to cause both mucosal and systemic infections, particularly in immunocompromised hosts .

What are the critical factors to consider when designing experiments with recombinant Candida glabrata MIA40?

When designing experiments with recombinant C. glabrata MIA40, researchers should consider the following critical factors:

  • Redox environment control: MIA40 function is highly dependent on redox conditions. Experiments should be performed under controlled redox environments, with consideration given to the presence of reducing agents (DTT, β-mercaptoethanol) or oxidizing agents (CuCl₂) as appropriate for the specific experimental goals.

  • Protein stability considerations: Recombinant MIA40 tends to aggregate upon repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week and avoid repeated freezing and thawing. For long-term storage, prepare aliquots with 50% glycerol and maintain at -20°C/-80°C .

  • Tag interference assessment: The His-tag commonly used for purification may potentially interfere with some MIA40 functions. Control experiments comparing tagged versus untagged proteins or using different tag positions (N-terminal versus C-terminal) should be considered for critical functional assays.

  • Buffer composition optimization: MIA40 activity is sensitive to buffer composition. Tris/PBS-based buffers at pH 8.0 are typically suitable, but specific applications may benefit from optimization of salt concentration, pH, and the presence of stabilizing agents like trehalose .

  • Substrate selection: When studying MIA40 function, the choice of substrate proteins is crucial. Classical substrates include small Tim proteins (Tim9, Tim10, Tim13) and Cox proteins (Cox17, Cox19), which should be available for comprehensive functional characterization .

What purification methods yield the highest quality recombinant MIA40 protein?

To obtain high-quality recombinant MIA40 protein, the following purification approach is recommended:

  • Expression system selection: E. coli is a suitable expression system for recombinant C. glabrata MIA40, allowing high-yield production of the protein. BL21(DE3) or similar strains designed for recombinant protein expression are recommended .

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for purifying His-tagged MIA40. A stepped or gradient elution with increasing imidazole concentrations (50-300 mM) helps separate MIA40 from contaminants.

  • Size exclusion chromatography: Following IMAC, size exclusion chromatography (SEC) helps remove aggregates and further enhances purity. This step is particularly important for functional studies as it ensures a homogeneous protein population.

  • Ion exchange chromatography: An additional ion exchange chromatography step may be included to remove remaining contaminants based on charge differences.

  • Quality control assessment: Purified MIA40 should be assessed for:

    • Purity: >90% as determined by SDS-PAGE

    • Homogeneity: Single peak on size exclusion chromatography

    • Activity: Functional assays testing disulfide bond formation with known substrates

    • Proper folding: Circular dichroism spectroscopy to confirm secondary structure

How can researchers troubleshoot common issues when working with recombinant MIA40?

When working with recombinant MIA40, researchers may encounter several challenges. Here are troubleshooting approaches for common issues:

Issue: Low protein solubility

  • Solution: Modify expression conditions (reduce temperature to 16-18°C, use lower IPTG concentrations)

  • Solution: Include solubility enhancers in lysis buffer (0.1% Triton X-100, 5-10% glycerol)

  • Solution: Express as fusion protein with solubility-enhancing tags (MBP, SUMO)

Issue: Poor oxidative folding activity

  • Solution: Verify redox state of purified MIA40 (non-reducing SDS-PAGE)

  • Solution: Include mild oxidant during final purification steps to ensure correct disulfide formation

  • Solution: Confirm buffer pH is optimal (typically pH 7.5-8.0)

  • Solution: Check for presence of metal contaminants that might interfere with thiol chemistry

Issue: Protein aggregation during storage

  • Solution: Store at appropriate concentration (0.1-1.0 mg/mL) with 50% glycerol at -80°C

  • Solution: Add stabilizers such as trehalose (6%) to storage buffer

  • Solution: Aliquot to avoid repeated freeze-thaw cycles

  • Solution: For working stocks, maintain at 4°C for maximum one week

Issue: Weak or absent interaction with substrate proteins

  • Solution: Verify substrate protein is in reduced state

  • Solution: Adjust redox conditions to favor disulfide exchange

  • Solution: Add CuCl₂ as a catalyst for disulfide bond formation

  • Solution: Ensure His-tag is not interfering with substrate binding site

How might structural analysis of Candida glabrata MIA40 inform therapeutic targeting strategies?

Structural analysis of C. glabrata MIA40 could provide valuable insights for therapeutic development:

  • Identification of unique structural features: Detailed structural analysis could reveal C. glabrata-specific features of MIA40 that differ from the human homolog (CHCHD4). These differences could be exploited for selective targeting of the fungal protein without affecting the host counterpart.

  • Catalytic site characterization: Resolving the structure of the catalytic CPC motif and surrounding regions would enable rational design of inhibitors that specifically block the oxidoreductase activity of MIA40, potentially disrupting mitochondrial function in C. glabrata.

  • Substrate binding interface mapping: Defining the substrate binding interface would allow for the development of peptidomimetic compounds that compete with natural substrates, preventing essential protein import into the mitochondrial IMS.

  • Allosteric regulation sites: Structural analysis might reveal allosteric sites that, when occupied by small molecules, could induce conformational changes affecting MIA40 function, providing additional targeting opportunities.

  • Protein-protein interaction interfaces: Characterizing the interfaces between MIA40 and its partner proteins (e.g., Erv1) could enable the design of molecules that disrupt these essential interactions, compromising the entire oxidative folding pathway.

Given that MIA40 is essential for mitochondrial function and C. glabrata viability, inhibitors targeting this protein could represent a novel class of antifungal agents with a mechanism distinct from current therapies, potentially addressing the problem of azole resistance in C. glabrata infections .

What is the relationship between MIA40 function and C. glabrata's resistance to oxidative stress?

The relationship between MIA40 function and C. glabrata's oxidative stress resistance presents an intriguing area for investigation:

Research exploring these connections could provide insights into C. glabrata pathogenicity, as oxidative stress resistance is a key virulence determinant that enables this pathogen to withstand host immune defenses .

What novel substrates of MIA40 remain to be discovered in Candida glabrata?

The exploration of novel MIA40 substrates in C. glabrata represents a promising frontier for research:

  • Beyond classical substrates: While small Tim proteins (Tim9, Tim10, Tim13) and Cox proteins (Cox17, Cox19) are well-established MIA40 substrates, the recent discovery of Tim22 as a MIA40 substrate suggests that many more proteins may rely on this pathway . Proteomic approaches comparing wild-type and MIA40-deficient mitochondria could reveal additional substrates.

  • Pathogen-specific substrates: C. glabrata may have evolved unique MIA40 substrates related to its pathogenic lifestyle. These could include proteins involved in stress resistance, metabolic adaptation to host environments, or defense against host immune responses.

  • Non-canonical substrates: Recent research has expanded our understanding of MIA40 function beyond classical twin CX₃C or CX₉C motif-containing proteins. Non-canonical substrates with different cysteine arrangements may exist, particularly proteins with single cysteine residues that form mixed disulfides with MIA40 during import.

  • Inner membrane proteins: The discovery that MIA40 assists in the biogenesis of Tim22, a multi-spanning inner membrane protein, opens the possibility that other inner membrane proteins may utilize MIA40 during their import and assembly . This represents a significant expansion of the potential MIA40 substrate repertoire.

  • Dual-targeted proteins: Some proteins are imported into both the mitochondria and other cellular compartments. Investigating whether MIA40 plays a role in the import of dual-targeted proteins could reveal novel functions and substrates.

Systematically identifying the complete set of MIA40 substrates would provide a comprehensive understanding of MIA40's role in C. glabrata mitochondrial biogenesis and potentially reveal novel connections to pathogenicity and antifungal resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.