Recombinant Candida glabrata Mitochondrial outer membrane protein CAGL0G03245g (CAGL0G03245g)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAGL0G03245g; IML2-like protein CAGL0G03245g
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-751
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
CAGL0G03245g
Target Protein Sequence
MFSFFGGNKAPELTQEEKTKLILQQAYDFEVALRAMDYVLDDNPERGLNLLKESDDSANE DERTINVLARGVIEFLEATLSFEAEEMKKASATLAKAETLSQKSKANAEKLNLSNSSKYP PGTVFAVTYTESLLLHALLMIFSESMMEVAKALLKLRKAYYTLQEVLEQIKAANEASITN AENNGEESKSSSASFISEGDIFNSIDIPYKLTEEEAKDKELLEFADKVHKMRAKRLSGAH IDNPPAINRLRNDLGLQAMNSLPKEEIKEHLPLSDDVDRSQATIDEFIHSGVNLCFGILQ VVLSLLPPAIGAVLSAVGFRGSREEGLRLVWKATKHRNVHGCIGLLGLMFYYDGPFQFTD DDFDVPASVKEYLNSTEDKKGQEENNDDTSTMTKDMESLKLKDDDLHMDSNTILHPGKIL EDALLKSRALFPNSALWLLNEARMLSGKGRLEDAVALMDSIDVNSIQMRQVKTLMIFDRA ITLIHLHEYDRAADDILSLLDISDWSHAFYSYFAGCCYLENWRMIQMGDLKSDKEEFYKE KATTLIFKSVDYLGKKTWRSKNLPLDRFVARKVDQFKAMQVKLNLTNPLDAIATGPVYEI AYFYNGFNRMSQKHLDISKKMLTEYKNPAVEANDPDQNLIRDLLVSLCLRRSDKIKEGCD LLDQKVLPTFFKELPDGKVEYVKKNEDPWLYPSALYERALFCWKLNGVQGLSECKEWLLR AQNYADDYELSSRVGMKIKAAIDRVDSALNN
Uniprot No.

Target Background

Function
Potentially involved in maintaining mitochondrial DNA stability.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is CAGL0G03245g and what are its general characteristics?

CAGL0G03245g is a mitochondrial outer membrane protein found in the pathogenic yeast Candida glabrata. As a transmembrane protein, it contains multiple membrane-spanning domains that anchor it to the outer mitochondrial membrane. The protein consists of 751 amino acids with a molecular structure that likely includes hydrophobic regions characteristic of membrane proteins.

To characterize CAGL0G03245g experimentally, researchers typically employ:

  • Subcellular fractionation followed by Western blotting

  • Fluorescent protein tagging (GFP fusion) for localization studies

  • Proteomic analysis of purified mitochondrial membranes

  • Prediction software for transmembrane domain identification

The amino acid sequence suggests potential functional domains, although these would require experimental validation through mutational analysis and functional assays specific to mitochondrial membrane proteins.

How is recombinant CAGL0G03245g produced for research purposes?

Recombinant CAGL0G03245g is produced using an in vitro E. coli expression system, with the following methodological approach:

  • Gene amplification and cloning into an expression vector containing an N-terminal 10xHis tag

  • Transformation into an appropriate E. coli strain optimized for membrane protein expression

  • Culture growth under controlled conditions with induction of protein expression

  • Cell harvest and membrane isolation

  • Solubilization using appropriate detergents to extract membrane proteins

  • Purification via metal affinity chromatography exploiting the His-tag

  • Further purification steps such as size exclusion chromatography if needed

  • Quality control including SDS-PAGE and Western blotting

The expression and purification of membrane proteins present special challenges compared to soluble proteins, often requiring optimization of detergent conditions and buffer compositions to maintain native conformation and function .

What are the optimal storage conditions for CAGL0G03245g?

For optimal stability and functionality of recombinant CAGL0G03245g, the following storage conditions are recommended:

Storage DurationRecommended TemperatureAdditional Considerations
Short-term-20°CAvoid repeated freeze-thaw cycles
Extended storage-20°C to -80°CAliquot before freezing
Working aliquots4°CUse within one week

The shelf life of liquid preparations is approximately 6 months when stored at -20°C/-80°C, while lyophilized forms can maintain stability for up to 12 months under the same conditions. As with many membrane proteins, the presence of appropriate stabilizing agents in the buffer (glycerol, specific detergents, protease inhibitors) is crucial for maintaining structural integrity during storage .

What functional assays can be used to characterize CAGL0G03245g activity?

Characterizing the function of CAGL0G03245g requires specialized assays for mitochondrial membrane proteins:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with potential binding partners

    • Proximity labeling techniques (BioID, APEX) for in vivo interaction mapping

    • Yeast two-hybrid screening with modifications for membrane proteins

    • Surface plasmon resonance for direct binding kinetics

  • Mitochondrial Function Assays:

    • Membrane potential measurements using fluorescent dyes

    • Protein import assays if involved in mitochondrial protein translocation

    • Mitochondrial morphology analysis in knockout vs. wild-type strains

    • Respiratory capacity measurements

  • In vitro Reconstitution:

    • Liposome incorporation for transport or channel activity studies

    • Electrophysiological measurements if the protein forms channels

  • Genetic Approaches:

    • Phenotypic analysis of gene deletion mutants

    • Complementation studies to verify functional roles

    • Site-directed mutagenesis of conserved residues

Assay selection should be guided by bioinformatic predictions of protein function and preliminary phenotypic observations in mutant strains .

How can CAGL0G03245g be compared to other mitochondrial membrane proteins in Candida species?

Comparative analysis of CAGL0G03245g with other mitochondrial proteins provides evolutionary and functional insights:

  • Sequence-Based Comparison:

    • Multiple sequence alignment with orthologs from related Candida species

    • Identification of conserved domains and motifs

    • Phylogenetic analysis to determine evolutionary relationships

    • Calculation of selection pressure (dN/dS ratios) on different protein regions

  • Structural Comparison:

    • Homology modeling based on proteins with known structures

    • Prediction of transmembrane topology and comparison across species

    • Identification of conserved structural features

  • Functional Comparison:

    • Cross-species complementation experiments

    • Comparative phenotypic analysis of deletion mutants

    • Assessment of expression patterns under similar conditions

  • Methodological Approach:

    • Database mining (UniProt, FungiDB) for ortholog identification

    • CLUSTAL or MUSCLE for multiple sequence alignment

    • MEGA or PhyML for phylogenetic tree construction

    • Structural prediction using AlphaFold2 or similar tools

This comparative approach can reveal whether CAGL0G03245g performs conserved functions common to all Candida species or represents a specialized adaptation in C. glabrata .

What genomic and proteomic approaches are most effective for studying CAGL0G03245g expression?

Understanding CAGL0G03245g expression patterns requires integrated genomic and proteomic approaches:

  • Transcriptomic Analysis:

    • RNA-Seq under various environmental conditions

    • qRT-PCR for targeted expression analysis

    • Promoter analysis to identify regulatory elements

    • ChIP-Seq to identify transcription factors regulating expression

  • Proteomic Methods:

    • Targeted mass spectrometry (MRM/PRM) for protein quantification

    • SILAC or TMT labeling for comparative proteomics

    • Pulse-chase experiments to determine protein turnover rates

    • Post-translational modification analysis

  • Reporter Systems:

    • Promoter-GFP fusions to monitor expression in live cells

    • CRISPR interference for controlled gene repression

    • Ribosome profiling to assess translation efficiency

  • Integrated Data Analysis:

    • Correlation of transcript and protein levels

    • Network analysis to identify co-expressed genes

    • Pathway enrichment analysis

These methods should be applied across relevant conditions such as during host cell interaction, exposure to stress factors, or antifungal treatment to understand the physiological context of CAGL0G03245g expression .

How might CAGL0G03245g contribute to Candida glabrata virulence and pathogenesis?

While specific data on CAGL0G03245g's role in virulence is limited, insights can be drawn from studies of other membrane proteins in C. glabrata:

  • Potential Mechanisms in Pathogenesis:

    • Maintenance of mitochondrial function during phagocytosis

    • Contribution to stress response networks (similar to CgDtr1's role)

    • Involvement in metabolic adaptation within host environments

    • Possible role in resistance to host defense mechanisms

  • Experimental Assessment Approaches:

    • Infection models such as Galleria mellonella larvae (as established for other virulence factors)

    • Competitive infection assays comparing wild-type and deletion mutants

    • Ex vivo macrophage infection assays to assess phagocyte survival

    • Transcriptional analysis during host-pathogen interaction

  • Correlative Evidence:

    • Expression pattern analysis during infection phases

    • Assessment of virulence attenuation in deletion mutants

    • Restoration of virulence through complementation

Other membrane proteins in C. glabrata, such as CgDtr1 (encoded by CAGL0M06281g), have been demonstrated to influence pathogenesis by enhancing survival within host immune cells and resistance to stress factors. CgDtr1 specifically increases C. glabrata virulence in the Galleria mellonella infection model by improving proliferation in hemolymph and resistance to hemocyte-mediated killing .

What role might CAGL0G03245g play in stress response and adaptation?

Mitochondrial membrane proteins often mediate cellular adaptation to environmental stress:

  • Potential Stress Response Functions:

    • Oxidative stress management (particularly relevant for mitochondrial proteins)

    • pH adaptation (similar to CgDtr1's role in acetic acid resistance)

    • Nutrient limitation response

    • Temperature stress adaptation

  • Experimental Approaches to Assess Stress Roles:

Stress ConditionMethodologyKey Measurements
Oxidative stressH₂O₂ or menadione exposureSurvival rates, ROS accumulation, mitochondrial membrane potential
pH stressGrowth in acidic mediaIntracellular pH, growth kinetics, expression changes
Nutrient limitationCarbon/nitrogen starvationMitochondrial morphology, respiratory capacity, ATP production
Antifungal exposureSub-inhibitory drug concentrationsDrug sensitivity, membrane integrity, stress response pathway activation
  • Comparative Analysis:

    • Stress phenotypes in wild-type vs. deletion mutants

    • Complementation studies to confirm specificity

    • Cross-resistance patterns to multiple stressors

The established role of other membrane transporters such as CgDtr1 in mediating acetic acid resistance suggests CAGL0G03245g might similarly contribute to specific stress tolerance mechanisms relevant during host colonization and infection .

How can structural information about CAGL0G03245g inform potential drug design?

Structural insights into CAGL0G03245g can facilitate rational approaches to antifungal development:

  • Structure Determination Approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for membrane protein structures

    • NMR spectroscopy for specific domains

    • Computational structure prediction using AlphaFold2 or RoseTTAFold

  • Drug Target Assessment Criteria:

    • Identification of druggable pockets or channels

    • Evaluation of essentiality for fungal survival

    • Assessment of structural divergence from human homologs

    • Analysis of conservation across resistant Candida strains

  • Structure-Based Drug Design Workflow:

    • Virtual screening against predicted binding sites

    • Fragment-based drug discovery targeting key functional regions

    • Molecular dynamics simulations of protein-ligand interactions

    • Structure-activity relationship studies for lead optimization

  • Validation Methods:

    • Binding assays using surface plasmon resonance or isothermal titration calorimetry

    • Functional inhibition assays

    • Co-crystallization with lead compounds

    • Mutagenesis of predicted binding site residues

Targeting fungal-specific features of mitochondrial membrane proteins can potentially provide selective antifungal activity with reduced host toxicity .

What are the common challenges in working with recombinant CAGL0G03245g and how can they be addressed?

Membrane proteins present specific experimental challenges that require specialized approaches:

  • Expression and Purification Challenges:

    • Low expression levels

    • Protein aggregation during extraction

    • Difficulty maintaining native conformation

    • Loss of function during purification

  • Methodological Solutions:

    • Use of specialized E. coli strains (C41/C43, Lemo21)

    • Optimization of detergent screening (DDM, LMNG, GDN)

    • Expression as fusion proteins with solubility enhancers

    • Co-expression with chaperones

    • Nanodiscs or liposome reconstitution to maintain native environment

  • Functional Analysis Challenges:

    • Difficult to assess activity outside native membrane

    • Complex protein-protein interactions

    • Limited structural information

  • Troubleshooting Approaches:

ChallengePotential SolutionImplementation Method
Protein aggregationDetergent optimizationSystematic screening of detergent types, concentrations, and temperature conditions
Low expressionCodon optimizationRedesign gene sequence for optimal codon usage in expression host
Loss of functionNative-like environmentReconstitution in liposomes mimicking mitochondrial membrane composition
Protein instabilityBuffer optimizationScreen additives (glycerol, arginine, specific lipids) to enhance stability

Addressing these challenges requires iterative optimization and combination of multiple approaches tailored to the specific properties of CAGL0G03245g .

How can researchers overcome technical difficulties in studying protein-protein interactions involving CAGL0G03245g?

Investigating protein-protein interactions for membrane proteins requires specialized techniques:

  • In vivo Interaction Methods:

    • Split-GFP complementation adapted for membrane proteins

    • Proximity-dependent biotinylation (BioID, TurboID)

    • FRET/BRET assays for dynamic interaction studies

    • Membrane yeast two-hybrid systems

  • In vitro Approaches:

    • Microscale thermophoresis for detecting interactions in solution

    • Surface plasmon resonance with captured proteins in nanodiscs

    • Pull-down assays with stabilized protein complexes

    • Hydrogen-deuterium exchange mass spectrometry

  • Computational Prediction:

    • Protein-protein docking simulations

    • Coevolution analysis to identify interacting interfaces

    • Network analysis based on functional genomics data

  • Validation Strategies:

    • Mutational analysis of predicted interaction interfaces

    • In vivo functional assays to confirm biological relevance

    • Comparative analysis across related species

    • Structural studies of protein complexes

These approaches should be combined for comprehensive characterization, as each method has inherent limitations when applied to membrane proteins like CAGL0G03245g .

What emerging technologies could advance our understanding of CAGL0G03245g function?

Several cutting-edge technologies show promise for deeper insights into CAGL0G03245g:

  • Advanced Structural Biology:

    • Cryo-electron tomography for visualizing proteins in their native membrane environment

    • Integrative structural biology combining multiple data types

    • Serial femtosecond crystallography for membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Genome Editing Advances:

    • CRISPR interference for conditional expression modulation

    • Base editing for precise amino acid substitutions

    • Prime editing for complex genetic modifications

    • Saturation mutagenesis combined with deep phenotyping

  • Single-Cell Technologies:

    • Single-cell RNA-Seq during infection to capture heterogeneous responses

    • Spatial transcriptomics to analyze expression in tissue context

    • Mass cytometry to profile protein expression at single-cell resolution

    • Microfluidic devices for real-time monitoring of single-cell responses

  • Systems Biology Approaches:

    • Multi-omics data integration

    • Network analysis to position CAGL0G03245g in cellular pathways

    • Machine learning for predicting functional partners

    • Metabolic flux analysis to assess mitochondrial function

These technologies could reveal dynamic aspects of CAGL0G03245g function during host-pathogen interactions that are not accessible through conventional approaches .

How might comparative studies across Candida species advance therapeutic strategies targeting mitochondrial membrane proteins?

Cross-species comparative analysis offers valuable insights for therapeutic development:

  • Evolutionary Conservation Analysis:

    • Identification of conserved domains as potential broad-spectrum targets

    • Detection of species-specific features for selective targeting

    • Analysis of natural variations in drug-binding regions

    • Assessment of compensatory pathways across species

  • Functional Comparison Methodologies:

    • Cross-species complementation to determine functional conservation

    • Heterologous expression studies to identify crucial regions

    • Comparative phenotypic profiling across deletion mutants

    • Analysis of protein-protein interaction networks across species

  • Therapeutic Implications:

Comparative FindingTherapeutic RelevanceImplementation Strategy
Highly conserved functional domainsPotential broad-spectrum targetStructure-based drug design targeting conserved pockets
Species-specific featuresSelective anti-C. glabrata activityTargeting unique structural elements or binding sites
Divergence from human homologsReduced host toxicityExploiting structural differences for selective binding
Conservation in resistant strainsPotential to overcome resistanceTargeting regions under functional constraint
  • Translation to Drug Development:

    • Rational design of inhibitors against conserved elements

    • Species-selective compound libraries

    • Combination strategies targeting multiple membrane proteins

    • Repurposing screens using structurally related targets

This comparative approach could identify both broad-spectrum and species-specific therapeutic opportunities while minimizing potential for toxic effects on human mitochondrial functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.