Recombinant Candida glabrata Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Candida glabrata Mitochondrial outer membrane protein IML2 (IML2) is a protein associated with the mitochondria of the yeast Candida glabrata . It is available as a partial recombinant protein .

Basic Information:

AttributeValue
Product CodeCSB-BP739703CZI1
AbbreviationIML2
Uniprot No.Q6FJV9
SourceBaculovirus
Target NameIML2
Protein NameMitochondrial outer membrane protein IML2
Immunogen SpeciesCandida glabrata
Purity>85% (SDS-PAGE)
Protein LengthPartial
Storage TemperatureLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C

Biological Context

Candida glabrata is a fungal species known for its increasing resistance to antifungal treatments . It employs various mechanisms to persist within host organisms, including metabolic flexibility and intracellular survival within macrophages . Understanding the function and interactions of proteins like IML2 may provide insights into the pathogenicity and drug resistance mechanisms of C. glabrata.

Related Research

While specific research focusing solely on IML2 is limited, studies on Candida glabrata have explored other proteins and their roles in virulence and inter-species interactions. For example, a secreted protein Yhi1 has been identified in C. glabrata that induces hyphal growth in Candida albicans, highlighting molecular communication between these species during mixed infections . Additional research has investigated cell wall proteins and their involvement in adhesion and biofilm formation, which are crucial processes in Candida infections .

Mating Signaling Pathway

The mating signaling pathway in C. glabrata regulates the expression and efflux of certain proteins . Although C. glabrata primarily reproduces asexually, this pathway is repurposed to interact with other Candida species . One study found that the protein CgMfa2 aids in the efflux of CgYhi1, which affects hyphal induction in C. albicans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
IML2; CAGL0M03179g; Inclusion body clearance protein IML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-743
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
IML2
Target Protein Sequence
MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIALRAMDYVLDDRTEEGLA LLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASNTLAKAEQLSWKSRTEAQK SGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAAKALLKLRKAYSMLHEIMEVV KKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQLSETESNDPELWAFAEKIYKMR KLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANSEQSVLSDEAAERQATIDEFIHSGV NLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEGLRLIWKATKDRNVHGCIGLLGLMFYY DGPFQFTDVDFDIPPALSNTKTSDSDTDRDGSISIDEMDGHALLHPGPILEEALLHARAL FPNSALWLLNEARMLSSRGRLPEAIELLDSIDVESIHMRQVKGLLVFDKAITLVHMQEYE RAATNLLSLLKISDWSHAFYTYFAGCCYLENWRMAQMGFIKDDKLEFYREKAEELIFSAP KLLGKKTFKSKNLPLDRFMLRKVEQFKATQKKLGVKNILDAIGTSPIREITYFYNGYNRM SKSDLEIAQKMLTSYHNPAIDQHDPDQELIKNLLLSLTMRRLGDVESGVKLLDEKVLPSI YYMQNGKVKYIKKTEDPWAYPTALYERALFTWKLDGVDNLSECRHWLVTAQNYAGDYELS TRVGMKIKAALDRVEESLQHGTA
Uniprot No.

Target Background

Function
An inclusion body (IB) resident protein exhibiting strong interaction with lipid droplet (LD) proteins. It participates in LD-mediated IB clearance following protein folding stress, likely by facilitating access to the IBs of an LD-stored soluble sterol derivative that functions as a chaperone in inclusion clearance.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is the role of mitochondrial outer membrane proteins like IML2 in Candida glabrata pathogenicity?

Mitochondrial outer membrane proteins in C. glabrata, including potential proteins like IML2, play crucial roles in maintaining mitochondrial function, morphology, and dynamics—all of which are linked to the pathogen's virulence and drug resistance mechanisms. Research indicates that mitochondrial dysfunction or morphological abnormalities contribute significantly to azole resistance in C. glabrata .

The ER-mitochondrial encounter structure (ERMES) complex, which includes several mitochondrial outer membrane proteins, facilitates critical processes including mitochondrial fission, distribution of mitochondrial DNA, and mitophagy . While IML2 is not specifically mentioned in the current literature as part of this complex, its potential interactions with ERMES components or parallel functions may contribute to similar cellular processes.

Methodologically, researchers investigating these proteins should employ mitochondrial visualization techniques using specific dyes like MitoBright LT Red, which has been successfully used to examine mitochondrial morphology in C. glabrata .

How does mitochondrial protein dysfunction relate to antifungal resistance in C. glabrata?

Mitochondrial protein dysfunction has been directly linked to antifungal resistance through several mechanisms:

  • Increased drug efflux: Deletion of GEM1, a GTPase that regulates the ERMES complex, leads to increased expression of drug efflux pumps encoded by CDR1 and CDR2 .

  • ROS signaling pathways: Cells lacking GEM1 display abnormal mitochondrial morphology and increased mitochondrial ROS (mtROS) levels . This oxidative stress appears to trigger cellular responses that include upregulation of drug resistance mechanisms.

  • Point mutations in functional domains: Even specific point mutations in GEM1 GTPase domains are sufficient to confer azole resistance , suggesting that subtle changes in mitochondrial protein function can dramatically alter drug susceptibility.

Researchers studying IML2 should consider similar mechanisms, potentially using antioxidant treatments like N-acetylcysteine (NAC) to assess the role of ROS signaling, as this approach has been shown to reduce both ROS production and the expression of CDR1 in GEM1-deficient strains .

What expression systems are most effective for producing recombinant C. glabrata mitochondrial proteins?

For optimal expression of C. glabrata mitochondrial membrane proteins like IML2, researchers should consider these methodological approaches:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- Rapid growth
- High yields
- Cost-effective
- Inclusion body formation
- Lacks eukaryotic PTMs
- Use C41/C43 strains
- Include fusion tags (MBP, SUMO)
- Low temperature induction
S. cerevisiae- Evolutionary proximity to C. glabrata
- Appropriate PTMs
- Similar membrane environment
- Lower yields than E. coli
- Slower growth
- Use strong inducible promoters
- Optimize codon usage
- Include C. glabrata targeting sequences
P. pastoris- High-density cultivation
- Strong promoters
- Proper protein folding
- Longer development time
- Glycosylation differs from C. glabrata
- Methanol-free promoter systems
- Optimize signal sequences
Baculovirus- Advanced eukaryotic PTMs
- Suitable for complex proteins
- Technical complexity
- Higher cost
- Optimize MOI
- Include chaperon co-expression

When expressing mitochondrial outer membrane proteins, it's crucial to maintain their native structure. For functional studies, S. cerevisiae may be particularly valuable as it shares significant homology with C. glabrata , potentially allowing proper targeting and folding.

How can researchers evaluate the impact of IML2 on mitochondrial morphology and function in C. glabrata?

To assess IML2's impact on mitochondrial morphology and function, researchers should implement a multi-faceted approach:

Experimental methodology:

  • Gene deletion and complementation analysis:

    • Generate ΔimL2 strains using CRISPR-Cas9 or traditional homologous recombination

    • Create point mutations in functional domains

    • Perform phenotypic rescue with wild-type and mutant variants

  • Mitochondrial morphology assessment:

    • Use mitochondria-specific fluorescent dyes like MitoBright LT Red

    • Implement live-cell confocal microscopy with z-stack imaging

    • Quantify morphological parameters (length, branching, fragmentation) using ImageJ with MiNA (Mitochondrial Network Analysis) plugins

  • Functional assays:

    • Measure oxygen consumption rate (OCR) using Seahorse XF analyzers

    • Assess membrane potential with JC-1 or TMRM fluorescent dyes

    • Quantify mtROS production using MitoSOX Red

    • Evaluate mtDNA maintenance through qPCR of mitochondrial genes

  • Biochemical interaction studies:

    • Investigate potential interactions with ERMES components through co-immunoprecipitation

    • Use BioID or APEX2 proximity labeling to identify the protein's interaction network

These methodologies have successfully revealed the impact of GEM1 deletion on mitochondrial morphology and ROS production in C. glabrata , and similar approaches would be valuable for characterizing IML2's function.

What role might IML2 play in C. glabrata drug resistance mechanisms compared to known factors?

While specific information about IML2's role in drug resistance is not directly available in the current literature, researchers can investigate its potential contributions through comparative studies with known resistance factors:

Research approach:

  • Transcriptional analysis:

    • Compare gene expression profiles between wild-type and ΔimL2 strains using RNA-seq

    • Focus specifically on known resistance genes (CDR1, CDR2, MDR1) as was done with GEM1

    • Perform qRT-PCR validation of key targets under various drug exposures

  • Azole susceptibility testing:

    • Determine minimum inhibitory concentrations (MICs) using broth microdilution

    • Conduct time-kill assays to assess fungicidal versus fungistatic effects

    • Perform checkerboard assays with ROS scavengers like NAC to determine if resistance mechanisms are ROS-dependent, as observed with GEM1

  • Efflux pump activity:

    • Measure rhodamine 6G or Nile red retention/efflux

    • Use flow cytometry to quantify population heterogeneity in efflux activity

    • Test pump inhibitors (FK506, verapamil) to determine the contribution of different efflux systems

  • Genetic interaction mapping:

    • Create double mutants with known resistance genes

    • Perform epistasis analysis to position IML2 in resistance pathways

    • Use synthetic genetic array (SGA) approaches to identify functional relationships

This systematic approach would allow researchers to determine whether IML2 contributes to resistance through mechanisms similar to GEM1 (ROS production, efflux pump regulation) or through novel pathways.

How do mutations in mitochondrial outer membrane proteins affect C. glabrata virulence in infection models?

Mutations in mitochondrial proteins can significantly impact C. glabrata virulence, as demonstrated by several studies:

In vivo findings and methodological considerations:

When studying IML2's impact on virulence, researchers should consider that subtle mutations may be more clinically relevant than complete gene deletions, as they can confer resistance advantages without severely compromising fitness in the host environment.

What structural and functional domains of IML2 are critical for its role in mitochondrial homeostasis?

To characterize the critical domains of IML2, researchers should employ a combination of bioinformatic prediction and experimental validation:

Domain analysis approach:

  • Sequence-based predictions:

    • Identify transmembrane domains using TMHMM or Phobius

    • Predict functional domains through comparison with other mitochondrial outer membrane proteins

    • Perform multiple sequence alignment with homologs across fungal species to identify conserved regions

  • Targeted mutagenesis:

    • Create a library of truncation mutants to map essential regions

    • Generate point mutations in predicted functional domains

    • Assess each mutant for:

      • Proper mitochondrial localization

      • Impact on mitochondrial morphology

      • Effect on drug susceptibility

      • Protein-protein interactions

  • Structural determination:

    • Express and purify domains for X-ray crystallography or NMR studies

    • Use cryo-electron microscopy for larger assemblies or protein complexes

    • Apply crosslinking mass spectrometry (XL-MS) to identify interaction interfaces

Based on studies of GEM1, which showed that specific point mutations in GTPase domains were sufficient to confer azole resistance , researchers should pay particular attention to potential enzymatic domains or interaction interfaces in IML2 that might similarly affect drug resistance pathways.

What are the optimal conditions for purifying functional recombinant IML2 protein?

Purification of mitochondrial membrane proteins like IML2 presents significant challenges. The following protocol outlines a methodology based on successful approaches with similar proteins:

Optimized purification protocol:

  • Expression conditions:

    ParameterRecommended ConditionsRationale
    Expression hostS. cerevisiae (preferred)Evolutionary proximity to C. glabrata
    VectorpRS426-GAL1 with C-terminal His8-TEV-FLAG tagDual affinity purification capability
    Growth temperature25°C post-inductionReduces aggregation
    Induction time16-20 hoursBalances yield and quality
    Media supplements0.1% glucose + 2% galactoseControlled induction
  • Membrane preparation:

    • Harvest cells and disrupt by mechanical homogenization

    • Separate mitochondria through differential centrifugation

    • Wash mitochondrial fraction with high salt buffer (500 mM NaCl)

    • Extract outer membrane using digitonin (2 mg/mL)

  • Solubilization and purification:

    • Solubilize membranes in 1% digitonin or 1% DDM

    • Include 0.1 mg/mL yeast polar lipid extract

    • Purify using tandem affinity chromatography:

      1. Ni-NTA affinity

      2. TEV cleavage

      3. Anti-FLAG affinity

    • Final size exclusion chromatography in 0.1% digitonin

  • Reconstitution methods:

    • For functional studies: reconstitute into nanodiscs using MSP1D1 scaffold

    • For structural studies: amphipol A8-35 exchange may improve stability

This approach has proven effective for other mitochondrial membrane proteins and maintains protein-lipid interactions critical for function.

How can researchers effectively study IML2's interactions with other mitochondrial and ERMES complex proteins?

To characterize IML2's protein interaction network, researchers should employ multiple complementary approaches:

Interaction mapping strategy:

  • In vivo proximity labeling:

    • Generate IML2-BioID or IML2-TurboID fusion constructs

    • Express in C. glabrata under native promoter

    • Identify biotinylated proteins through streptavidin pulldown and mass spectrometry

    • This approach effectively captures transient and membrane protein interactions in their native environment

  • Co-immunoprecipitation with membrane adaptations:

    • Use GFP-Trap or FLAG-based immunoprecipitation

    • Solubilize membranes with mild detergents (digitonin 1%)

    • Consider chemical crosslinking (DSP, 1 mM) prior to solubilization

    • Western blot for known ERMES components (Mdm10, Mdm34, Gem1)

  • Split reporter assays:

    • Create libraries of ERMES components fused to split GFP/luciferase

    • Test against IML2 fused to complementary reporter fragment

    • Visualize interactions through confocal microscopy or luminescence detection

  • Genetic interaction analysis:

    • Generate double mutants (ΔimL2 with ΔERMES components)

    • Assess synthetic lethality/sickness phenotypes

    • Perform suppressor screens to identify functional relationships

These approaches have successfully revealed interaction networks for mitochondrial proteins in fungi and would provide valuable insights into IML2's functional relationships with the ERMES complex and other mitochondrial components.

How might targeting IML2 or related mitochondrial proteins offer new therapeutic approaches against resistant C. glabrata infections?

Based on our understanding of mitochondrial proteins' roles in drug resistance, targeting IML2 or related proteins presents several therapeutic opportunities:

Therapeutic strategies:

  • Inhibition of resistance pathways:

    • Develop compounds that prevent the mitochondrial dysfunction-driven upregulation of drug efflux pumps (CDR1, CDR2)

    • Target the ROS-dependent signaling pathways that link mitochondrial function to resistance mechanisms

    • Design combination therapies with existing antifungals and mitochondrial-targeting agents

  • Exploitation of metabolic vulnerabilities:

    • Identify metabolic dependencies created by mitochondrial dysfunction

    • Target alternate energy generation pathways upregulated in resistant strains

    • Develop mitochondrial uncouplers specific to fungal mitochondria

  • ERMES complex disruption:

    • Design peptide mimetics that interfere with protein-protein interactions within the ERMES complex

    • Target specific domains of GEM1 or other components that regulate complex function

    • Develop small molecules that destabilize the complex without affecting human mitochondrial proteins

  • Antioxidant therapy approach:

    • The finding that N-acetylcysteine (NAC) reduces both ROS production and CDR1 expression in GEM1-deficient strains suggests that targeted antioxidant therapy could potentially resensitize resistant C. glabrata to azole antifungals

    • Clinical studies could evaluate combined azole-antioxidant treatment regimens

These approaches offer promising directions for overcoming the increasing challenge of drug-resistant C. glabrata infections in clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.