Recombinant Candida glabrata Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

TPC1 in Candida glabrata (Gene ID: CAGL0G03135g) functions as a mitochondrial transporter responsible for shuttling thiamine pyrophosphate (TPP), a crucial coenzyme in carbohydrate metabolism . This carrier protein ensures adequate TPP levels within mitochondria, supporting essential biochemical pathways like the citric acid cycle and pyruvate dehydrogenase activity. Recombinant versions are engineered for experimental studies, enabling precise investigations into fungal metabolism and drug target identification.

Production and Purification

Recombinant TPC1 is generated through heterologous expression in E. coli, followed by affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resins targeting the His-tag . This method yields milligram quantities suitable for:

  • Enzymatic assays: Measuring TPP uptake kinetics in reconstituted liposomes.

  • Antibody development: Generating monoclonal/polyclonal antibodies for cellular localization studies.

  • Structural studies: X-ray crystallography or cryo-EM to resolve transport mechanisms .

Metabolic Studies

TPC1 facilitates investigations into C. glabrata’s metabolic adaptability, particularly under nutrient-limited conditions mimicking host environments . Its role in TPP transport links mitochondrial function to virulence potential.

Antifungal Target Exploration

As a mitochondrial protein, TPC1 is a candidate for novel antifungals. Inhibitors disrupting TPP transport could impair energy metabolism, offering a therapeutic strategy against drug-resistant strains .

Limitations and Future Directions

Current recombinant TPC1 lacks eukaryotic post-translational modifications, potentially affecting functional studies. Future work may employ yeast or mammalian expression systems to address this. Additionally, in vivo validation of TPC1’s role in pathogenesis remains unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
TPC1; CAGL0G03135g; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
TPC1
Target Protein Sequence
MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE LFMNKLG
Uniprot No.

Target Background

Function
A mitochondrial transporter mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Mitochondrial Thiamine Pyrophosphate Carrier 1 in C. glabrata?

Mitochondrial Thiamine Pyrophosphate Carrier 1 (TPC1) in Candida glabrata is responsible for transporting thiamine pyrophosphate (TPP) across the mitochondrial membrane. TPP serves as an essential cofactor for key metabolic enzymes including pyruvate dehydrogenase and α-ketoglutarate dehydrogenase complexes involved in cellular respiration. The transport of TPP into mitochondria is particularly critical for C. glabrata because this opportunistic pathogen is auxotrophic for thiamine, meaning it cannot synthesize the pyrimidine precursor needed for thiamine biosynthesis . TPC1 therefore represents an important component of the adaptive thiamine acquisition strategy of C. glabrata, facilitating energy metabolism by ensuring TPP availability in the mitochondrial matrix where it is required for essential enzymatic reactions.

How does TPC1 differ structurally from other mitochondrial carriers in C. glabrata?

TPC1 from C. glabrata is a 307-amino acid protein that belongs to the mitochondrial carrier family . Like other members of this family, TPC1 likely contains six transmembrane domains arranged in three repeats, creating a characteristic three-fold pseudosymmetry. What distinguishes TPC1 from other mitochondrial carriers is its specific substrate-binding pocket that accommodates thiamine pyrophosphate. The protein contains conserved signature motifs of mitochondrial carriers including PX[D/E]XX[K/R] repeats. These structural features establish specificity for TPP transport while maintaining the typical carrier protein fold. Studies examining TPC1's purified recombinant form with an N-terminal His tag reveal that these structural characteristics are preserved in the recombinant protein, making it suitable for structural and functional analyses.

What is the relationship between TPC1 and the thiamine biosynthetic pathway in C. glabrata?

In C. glabrata, TPC1 functions as a critical component of thiamine utilization rather than thiamine synthesis. Unlike its relative Saccharomyces cerevisiae, C. glabrata has lost several components of the thiamine biosynthetic (THI) pathway, including THI2, making it auxotrophic for thiamine . The organism has adapted by developing sophisticated thiamine acquisition mechanisms regulated by the transcription factor CgPdc2, which upregulates thiamine biosynthetic and transport genes under thiamine starvation conditions . TPC1 functions downstream of thiamine uptake and phosphorylation, ensuring that the activated cofactor TPP reaches mitochondrial enzymes. This is part of a metabolic adaptation strategy that involves both upregulation of thiamine transporters and efficient distribution of the limited available thiamine to cellular compartments where it is most needed for survival and virulence.

What expression systems are optimal for producing functional recombinant C. glabrata TPC1?

For producing functional recombinant C. glabrata TPC1, Escherichia coli expression systems have been successfully employed . The methodology involves:

  • Gene optimization for bacterial expression (codon optimization for E. coli)

  • N-terminal His-tag fusion for purification purposes

  • Expression using T7 promoter-based vectors such as pET series

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, cost-effective, rapid expressionPotential improper folding of membrane proteinsStructural studies, antibody production
Yeast (P. pastoris)Post-translational modifications, native-like membrane environmentLower yield, longer expression timeFunctional studies, activity assays
Insect cellsComplex eukaryotic protein processingHigher cost, technical complexityStudies requiring authentic eukaryotic modifications
Cell-free systemsRapid, avoids toxicity issuesLower yield, expensiveDifficult-to-express variants

The choice should be guided by whether structural or functional studies are the primary objective. For membrane proteins like TPC1, ensuring proper folding is critical for maintaining transport function.

What purification strategies yield the highest purity and activity for recombinant TPC1?

Purification of recombinant TPC1 with maintained transport activity requires careful consideration of detergent selection and purification conditions. The recommended methodological approach includes:

  • Initial solubilization using mild detergents (DDM, LMNG, or digitonin)

  • Metal affinity chromatography utilizing the N-terminal His-tag

  • Size-exclusion chromatography to remove aggregates

  • Optional ion-exchange chromatography for higher purity

Critical parameters affecting purification outcome include:

  • Buffer composition: 20-50 mM Tris or HEPES (pH 7.5-8.0), 100-300 mM NaCl

  • Detergent concentration: Maintain above CMC but below levels causing protein denaturation

  • Temperature: Conduct all purification steps at 4°C to minimize protein degradation

  • Protease inhibitors: Include a complete cocktail to prevent degradation

  • Reducing agents: Add 1-5 mM DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

For reconstitution into proteoliposomes for functional assays, a lipid mixture resembling mitochondrial membrane composition (containing cardiolipin) is recommended to preserve native-like activity.

How can researchers verify the proper folding and activity of purified recombinant TPC1?

Verification of proper folding and activity of purified recombinant TPC1 requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Thermal stability assays (DSF/nanoDSF) to assess protein stability

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify monodispersity

  • Functional verification:

    • Liposome reconstitution followed by transport assays using radiolabeled TPP

    • Membrane potential-sensitive fluorescent dyes to monitor transport activity

    • Substrate binding assays using isothermal titration calorimetry (ITC)

  • Structural integrity:

    • Limited proteolysis to assess domain organization and folding

    • Intrinsic fluorescence to evaluate tertiary structure

A properly folded TPC1 should demonstrate α-helical content consistent with its transmembrane domains, thermostability with Tm >40°C, and specific binding to TPP with affinity in the micromolar range. Functional assays should confirm TPP transport with kinetic parameters comparable to those of native mitochondrial preparations.

How does TPC1 function relate to C. glabrata virulence and pathogenicity?

TPC1 function is intricately connected to C. glabrata virulence through its role in cellular energy metabolism and stress adaptation. While not directly studied, several lines of evidence support this relationship:

  • C. glabrata employs chromatin remodeling as a central regulator of survival strategies within host macrophages, which facilitates reprogramming of cellular energy metabolism . As TPP is an essential cofactor for key metabolic enzymes, TPC1's function in delivering TPP to mitochondria likely supports this metabolic adaptation.

  • Thiamine acquisition is critical for C. glabrata survival since it is auxotrophic for thiamine . During infection, competition for limited thiamine in host niches makes efficient TPP transport systems like TPC1 potentially essential for virulence.

  • In macrophage-internalized C. glabrata cells, energy metabolism is deregulated in mutants with defective chromatin organization . This suggests that proper mitochondrial function, which depends on TPP availability through transporters like TPC1, is important for survival in the host.

  • Mixed-species invasive candidiasis involving C. glabrata and C. albicans relies on molecular communication between species . The metabolic state of C. glabrata, supported by proper mitochondrial function, may influence these interspecies interactions.

Researchers investigating TPC1's role in virulence should consider generating conditional knockout strains since complete deletion might severely impact growth, complicating virulence studies.

What structural features of TPC1 could be targeted for antifungal drug development?

TPC1 presents several potentially druggable structural features that could be exploited for antifungal development:

  • Substrate binding pocket: The TPP binding site contains unique residues that distinguish it from human mitochondrial carriers. Compounds that competitively bind this pocket could selectively inhibit fungal TPC1.

  • Conformational transition regions: Mitochondrial carriers undergo conformational changes during transport. Molecules that lock TPC1 in a specific conformation could prevent transport cycling.

  • Species-specific regulatory domains: Regions unique to fungal TPC1 that regulate its activity could provide selectivity over human orthologs.

Molecular docking studies using a homology model of TPC1 based on related mitochondrial carriers could identify the following potential binding sites:

RegionResidue RangePotential for SelectivityDruggability Score
Cytosolic gate25-40, 125-140, 225-240ModerateHigh
Central cavity80-100, 180-200, 280-300HighModerate
Matrix gate50-70, 150-170, 250-270HighHigh

Targeting regions with significant sequence divergence from human carriers would minimize potential toxicity. Structure-based drug design efforts should focus on compounds that can penetrate both the fungal cell wall and mitochondrial membranes while maintaining specificity for fungal TPC1.

How can TPC1 be used in studies of thiamine-dependent metabolic adaptations in C. glabrata?

Recombinant TPC1 serves as a valuable tool for investigating thiamine-dependent metabolic adaptations in C. glabrata through several experimental approaches:

  • Reconstituted transport systems:

    • Purified recombinant TPC1 reconstituted in liposomes allows measurement of TPP transport kinetics under different conditions

    • These systems can reveal how environmental factors (pH, membrane potential, metabolite concentrations) regulate transport activity

  • Protein-protein interaction studies:

    • Immobilized recombinant TPC1 can identify interacting proteins that may regulate its function

    • This approach can uncover connections between thiamine transport and other cellular processes

  • In vivo manipulation experiments:

    • Controlled expression of modified TPC1 variants in C. glabrata (gain/loss of function)

    • Correlation of TPC1 activity with adaptive responses to thiamine limitation

  • Metabolic flux analysis:

    • Using isotope-labeled thiamine to track TPP-dependent metabolic pathways

    • Comparing wild-type to TPC1-modified strains to determine metabolic rerouting

This research is particularly relevant given that C. glabrata has lost key components of the thiamine biosynthetic pathway, including THI2, making it auxotrophic for thiamine . Under thiamine starvation conditions, C. glabrata upregulates genes involved in thiamine acquisition through the transcription factor CgPdc2 . Understanding how TPC1 responds to these regulatory systems provides insight into the metabolic plasticity that enables C. glabrata to thrive in diverse host environments with varying thiamine availability.

What are the main challenges in studying TPC1 interactions with other proteins in the thiamine metabolic network?

Studying TPC1 interactions within the thiamine metabolic network presents several methodological challenges:

  • Membrane localization complexity: TPC1's integration in the mitochondrial membrane complicates traditional protein-protein interaction assays. Conventional yeast two-hybrid systems are ineffective for membrane proteins.

  • Native expression levels: TPC1 is likely expressed at low levels, making detection of endogenous interactions difficult.

  • Transient interactions: Many interactions in transport networks are transient, requiring specialized techniques for capture.

  • Compartmentalization: Capturing interactions that occur specifically within mitochondria requires organelle-specific approaches.

To overcome these challenges, researchers should consider:

  • Split-ubiquitin membrane yeast two-hybrid systems specifically designed for membrane proteins

  • Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity of TPC1 in intact mitochondria

  • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Co-immunoprecipitation with membrane-compatible detergents followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) imaging to visualize interactions in live cells

These approaches should be applied in both normal and thiamine-depleted conditions to identify context-dependent interactions, particularly focusing on connections with the pyruvate decarboxylase system and other thiamine-dependent pathways regulated by CgPdc2 .

How can researchers address stability issues when working with recombinant TPC1?

Membrane proteins like TPC1 present significant stability challenges during expression, purification, and experimental manipulation. Researchers can implement these methodological solutions:

  • Expression optimization:

    • Screen multiple constructs with varying N- and C-terminal boundaries

    • Test fusion partners (SUMO, MBP, GFP) that enhance folding and stability

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Purification stability enhancements:

    • Implement high-throughput detergent screening to identify optimal solubilization conditions

    • Include specific lipids (cardiolipin, PE) during purification to stabilize native conformations

    • Add substrate (TPP) during purification to stabilize the binding-competent conformation

  • Storage and handling:

    • Determine optimal buffer compositions using differential scanning fluorimetry

    • Test cryoprotectants (glycerol, sucrose) for long-term storage

    • Minimize freeze-thaw cycles and aliquot purified protein

  • Stability assessment metrics:

MethodParameter MeasuredAcceptance CriteriaTroubleshooting
SEC profileMonodispersitySingle symmetric peakOptimize detergent/lipid ratio
Thermal shiftMelting temperatureTm ≥ 40°CScreen stabilizing additives
Activity retentionTransport function≥70% after 48h at 4°CAdd stabilizing ligands
Limited proteolysisResistance to digestionDiscrete pattern maintainedModify purification buffers

For particularly challenging variants, nanobody or synthetic antibody fragments that bind and stabilize specific conformations of TPC1 can dramatically improve protein stability while maintaining native-like states for functional and structural studies.

What controls are essential when studying TPC1 function in relation to thiamine metabolism?

  • Negative controls:

    • Non-functional TPC1 mutants (point mutations in conserved residues)

    • Empty expression vectors in complementation studies

    • Liposomes without reconstituted protein in transport assays

    • Non-substrate analogs in binding studies

  • Positive controls:

    • Known functional mitochondrial carriers expressed under identical conditions

    • Previously characterized TPC1 preparations with established activity

    • Transport assays with alternative substrates for carrier specificity determination

  • Environmental controls:

    • Thiamine-replete versus thiamine-depleted conditions

    • Normal versus stress conditions (oxidative stress, nutrient limitation)

    • Variations in carbon sources that affect thiamine-dependent metabolism

  • Genetic context controls:

    • TPC1 expression in wild-type versus thiamine metabolism mutant backgrounds

    • Complementation with human or S. cerevisiae orthologs to assess functional conservation

    • Expression in CgPdc2 deletion mutants to understand regulatory context

  • Technical validation controls:

    • Multiple methods to confirm the same finding (e.g., transport activity by both radioisotope and fluorescence assays)

    • Concentration gradients of substrates and inhibitors to establish specificity

    • Time-course studies to distinguish equilibrium from kinetic effects

When studying TPC1 in the context of C. glabrata chromatin regulation , additional controls comparing wild-type to chromatin organization mutants (Cgrsc3-aΔ, Cgrtt109Δ) would help elucidate connections between epigenetic regulation and thiamine-dependent metabolism under host-relevant conditions.

How might TPC1 function be affected by interspecies interactions between C. glabrata and other Candida species?

Recent research has revealed that C. glabrata engages in complex molecular interactions with C. albicans during mixed-species infections, with C. albicans being near-essential for host colonization by C. glabrata . In this context, TPC1 function may be significantly modulated:

  • Metabolic adaptation in mixed biofilms: When C. glabrata coexists with C. albicans in mixed biofilms, metabolic cross-feeding likely occurs. TPC1 activity might be regulated differently in response to altered thiamine availability or metabolic signals from C. albicans.

  • Response to interspecies signaling molecules: C. glabrata secretes the protein Yhi1 that induces hyphal growth in C. albicans . Similar signaling molecules from C. albicans may influence C. glabrata metabolism, potentially altering thiamine requirements and TPC1 regulation.

  • Adaptation to host microenvironments: During mixed infections, C. albicans creates distinct microenvironments through tissue invasion and immune modulation. TPC1 function may be regulated differently in these altered niches where thiamine availability and metabolic requirements change.

  • Stress response coordination: Interspecies communication may synchronize stress responses. Since chromatin remodeling is crucial for C. glabrata survival in macrophages and affects energy metabolism, TPC1-dependent TPP transport may be adjusted as part of this coordinated response.

Researchers investigating this area should design experiments comparing TPC1 expression, localization, and activity in C. glabrata monocultures versus mixed cultures with C. albicans or in media conditioned by C. albicans. Particular attention should be paid to conditions that mimic the host environment during mixed-species infections.

What role might TPC1 play in C. glabrata adaptation to different host niches?

TPC1 likely plays a nuanced role in C. glabrata adaptation to diverse host microenvironments:

  • Thiamine-limited environments: In host niches where thiamine is scarce, efficient TPP transport via TPC1 becomes critical for survival. C. glabrata is auxotrophic for thiamine , making TPC1 potentially essential in thiamine-restricted host environments.

  • Macrophage phagosome adaptation: C. glabrata modifies its chromatin structure and reprograms energy metabolism when internalized by macrophages . TPC1-mediated TPP transport supports mitochondrial function during this metabolic adaptation, potentially contributing to survival within immune cells.

  • Carbon source flexibility: Different host niches contain various carbon sources requiring different metabolic pathways. Many of these pathways rely on TPP-dependent enzymes, making TPC1 function important for metabolic flexibility.

  • Hypoxic adaptation: Some host niches are oxygen-limited, requiring metabolic adjustments. TPP-dependent enzymes play roles in both aerobic and anaerobic metabolism, suggesting TPC1 importance in oxygen-limited environments.

  • Stress response coordination: TPC1 may contribute to coordinated stress responses involving both metabolic adaptation and chromatin remodeling, which are known to be important for C. glabrata virulence .

Experimental approaches to investigate these adaptations should include:

  • TPC1 expression analysis in C. glabrata isolated from different host tissues

  • Creation of conditional TPC1 mutants to assess fitness in various host-mimicking conditions

  • In vivo competition assays between wild-type and TPC1-deficient strains

  • Metabolomic profiling of TPC1 mutants in different simulated host environments

How can advanced structural biology techniques enhance our understanding of TPC1 function?

Cutting-edge structural biology approaches offer unprecedented opportunities to elucidate TPC1 function:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle cryo-EM can resolve TPC1 structure in different conformational states

    • This reveals the transport mechanism and substrate recognition determinants

    • Recent advances allow membrane protein structures below 3Å resolution

    • Sample preparation should include amphipols or nanodiscs to maintain native-like environment

  • Integrative structural biology:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS)

    • Creates comprehensive models of TPC1 in various functional states

    • Reveals dynamic aspects not captured by static structures

  • In-cell structural studies:

    • Approaches like in-cell NMR and proximity labeling

    • Reveals TPC1 structure and interactions in native mitochondrial environment

    • Provides context for understanding regulation in the cellular milieu

  • Molecular dynamics simulations:

    • Atomistic simulations of TPC1 in membrane environments

    • Predicts substrate transport pathway and energy barriers

    • Identifies potential binding sites for inhibitors or regulators

  • Time-resolved structural methods:

    • Techniques like time-resolved cryo-EM and X-ray free electron laser (XFEL) studies

    • Captures transient states during the transport cycle

    • Reveals kinetic aspects of the transport mechanism

These approaches would particularly benefit from comparing TPC1 structures under conditions mimicking the altered chromatin and metabolic states observed in macrophage-internalized C. glabrata . This would connect structural insights to the pathogen's adaptation strategies during infection, potentially revealing novel intervention points.

What are the most promising research directions for TPC1 in fungal pathogenesis studies?

The most promising research directions for TPC1 in fungal pathogenesis include:

  • Metabolic dependency mapping: Systematically identifying which pathogenesis-related processes depend on proper TPC1 function would reveal its role in virulence. This includes studying how TPC1 supports the metabolic adaptations required for survival in host immune cells, particularly considering the known importance of chromatin remodeling and energy metabolism reprogramming in macrophage-internalized C. glabrata .

  • Interspecies interaction dynamics: Investigating how TPC1 function is modulated during C. glabrata interactions with C. albicans in mixed infections . This could reveal novel aspects of metabolic cooperation or competition between fungal species during infection.

  • Integration with stress response networks: Exploring how TPC1 activity is coordinated with stress response pathways, especially those involving chromatin reorganization , to facilitate adaptation to changing host environments.

  • Drug target validation: Developing conditional TPC1 mutants and testing their virulence in various infection models would validate TPC1 as a potential antifungal target. Special attention should be paid to differences from human orthologs that could be exploited for selective inhibition.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and metabolomic data to position TPC1 within broader adaptive networks activated during infection, particularly in the context of thiamine acquisition strategies employed by the thiamine-auxotrophic C. glabrata .

These directions would significantly advance our understanding of how fundamental metabolic processes supported by TPC1 contribute to the remarkable adaptability and pathogenicity of C. glabrata.

What methodological innovations would accelerate research on mitochondrial carriers like TPC1?

Several methodological innovations would substantially accelerate research on mitochondrial carriers like TPC1:

  • Advanced membrane mimetics:

    • Lipid nanodisc systems with precisely controlled lipid composition

    • Polymer-based membrane mimetics optimized for stability and functionality

    • These would provide stable, native-like environments for functional and structural studies

  • High-throughput activity assays:

    • Fluorescence-based transport assays compatible with plate readers

    • Label-free detection systems for monitoring transport in real-time

    • These would enable large-scale screening of conditions and inhibitors

  • Genetic tools for mitochondrial proteins:

    • CRISPR-based systems for precise manipulation of mitochondrial protein genes

    • Conditional expression systems specific for mitochondrial proteins

    • Mitochondria-targeted proteomics approaches to study low-abundance carriers

  • Advanced microscopy:

    • Super-resolution microscopy methods for visualizing TPC1 distribution and dynamics

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Live-cell imaging approaches to monitor transport in real-time

  • Computational approaches:

    • Machine learning models predicting transport properties from sequence

    • Advanced homology modeling specifically optimized for membrane proteins

    • Virtual screening pipelines for identifying selective inhibitors

These innovations would be particularly valuable for studying the connections between mitochondrial carrier function and the broader cellular adaptations that C. glabrata employs during host colonization, especially the chromatin remodeling and metabolic reprogramming observed during macrophage interactions .

How might insights from TPC1 research contribute to broader understanding of metabolite transport in fungal pathogens?

Research on TPC1 in C. glabrata offers valuable insights that extend to metabolite transport in fungal pathogens more broadly:

  • Evolutionary adaptation of transport systems: C. glabrata has lost components of the thiamine biosynthetic pathway but has adapted its transport systems to compensate. Understanding how TPC1 has evolved in this context provides insights into how nutrient transport systems adapt during the evolution of pathogenicity.

  • Metabolic integration during host adaptation: TPC1 research reveals how mitochondrial metabolite transport integrates with broader cellular adaptations during host colonization, particularly the connection to chromatin remodeling observed in macrophage-internalized C. glabrata .

  • Interspecies metabolic interactions: Studies on how TPC1 function is influenced by C. glabrata interactions with C. albicans provide models for understanding metabolic interdependence in polymicrobial infections.

  • Transport-based drug targeting paradigms: TPC1 research establishes principles for targeting mitochondrial transporters as an antifungal strategy, potentially applicable to other essential transport systems in fungal pathogens.

  • Specialized methodology development: Technical approaches optimized for studying TPC1 will benefit research on other challenging membrane transporters in pathogenic fungi.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.