Recombinant Candida glabrata NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MCR1; CAGL0E06424g; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
MCR1
Target Protein Sequence
MAFARFARPTQRFLPFAIGAVAVTAGALYLNGWNTIKNENPKVFIGDRKWIDLELEKIIE ESHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVSDLSEKGYIEFVIK HYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQ NKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITK DFLAKNAPGPKEKTQVFVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQDQVFKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the primary function of NADH-cytochrome b5 reductase 2 (MCR1) in Candida glabrata?

NADH-cytochrome b5 reductase 2 (MCR1) in C. glabrata functions as a critical component of the electron transport system that transfers electrons from NADH to cytochrome b5. This enzyme catalyzes the reduction of cytochrome b5 using NADH as an electron donor. The resulting reduced cytochrome b5 can then donate electrons to various acceptor proteins, including cytochrome P450 enzymes involved in sterol biosynthesis. MCR1 plays a particularly important role in the alternative electron transport pathway that supports CYP51-mediated sterol 14α-demethylation, a critical step in ergosterol biosynthesis . This alternative pathway enables continued ergosterol production even when the primary NADPH cytochrome P450 reductase (CPR) pathway is compromised or inhibited.

How does MCR1 contribute to antifungal resistance mechanisms?

MCR1 contributes to antifungal resistance by facilitating an alternative electron transport pathway that enables continued ergosterol biosynthesis despite the presence of azole antifungals. Research has shown that the cytochrome b5/NADH cytochrome b5 reductase system can wholly and efficiently support CYP51-mediated sterol 14α-demethylation, which is targeted by azole antifungals . When the primary electron donor (NADPH cytochrome P450 reductase) is inhibited, this alternative pathway may allow C. glabrata to maintain sufficient ergosterol production for cell membrane integrity and function. This mechanism potentially contributes to the persistence of C. glabrata infections during antifungal therapy and represents an important consideration in understanding treatment failures.

What is the relationship between MCR1 and the pleiotropic drug response network?

While MCR1 itself is not directly part of the pleiotropic drug response (PDR) network, it interacts with cellular systems that influence antifungal susceptibility. The PDR network in C. glabrata is primarily defined by the transcription factor Pdr1 and its target genes such as CDR1, which encodes an ATP-binding cassette transporter that functions as a drug efflux pump . MCR1's role in maintaining ergosterol biosynthesis may complement the PDR network's functions by providing metabolic flexibility when C. glabrata faces antifungal stress. The alternative electron transport system involving MCR1 represents a distinct but potentially cooperative mechanism alongside the PDR network for mitigating the effects of antifungal drugs, particularly those targeting ergosterol biosynthesis.

How is recombinant C. glabrata MCR1 typically expressed and purified for research purposes?

Recombinant C. glabrata MCR1 is typically expressed using bacterial or yeast expression systems. For bacterial expression, the MCR1 gene can be cloned into expression vectors such as pET systems, transformed into E. coli strains (commonly BL21(DE3)), and induced with IPTG. For yeast expression, Pichia pastoris or Saccharomyces cerevisiae systems may be preferred to maintain proper protein folding and post-translational modifications. Purification typically employs affinity chromatography using histidine tags (His-tags) followed by size exclusion and/or ion exchange chromatography to achieve high purity. When studying the interaction between MCR1 and cytochrome b5, co-expression systems may be utilized to facilitate complex formation and stability. Enzyme activity assays typically monitor the rate of cytochrome b5 reduction using spectrophotometric methods that track the characteristic absorption changes at 424 nm as cytochrome b5 transitions between oxidized and reduced states.

How can researchers distinguish between direct xenobiotic sensing and stress-response activation of electron transport systems in C. glabrata?

Distinguishing between direct xenobiotic sensing and stress-response activation requires sophisticated experimental approaches that separate immediate molecular interactions from downstream cellular adaptations. Recent research has challenged the hypothesis that transcription factors like Pdr1 directly sense xenobiotics, instead supporting the alternative hypothesis that these factors sense cellular stresses arising from xenobiotic action on their established targets . To differentiate these mechanisms for electron transport systems including MCR1, researchers should implement: (1) Time-course experiments comparing the kinetics of gene expression changes—rapid responses suggest direct sensing while delayed responses indicate stress adaptation; (2) Use of reporters driven by the MCR1 promoter to monitor activation patterns, as demonstrated with CDR1 promoter studies showing distinct activation kinetics for different stressors ; (3) Site-directed mutagenesis of potential xenobiotic binding domains in regulatory proteins to assess if response is maintained; and (4) Metabolomic profiling to identify stress-signaling molecules that may mediate between primary drug targets and transcriptional responses. The research on Pdr1 showing that fluconazole activated it with slow kinetics correlating with cellular stress onset provides a methodological template for such investigations .

What are the structural and functional distinctions between MCR1 and other NADH-dependent reductases in C. glabrata that might influence drug resistance?

The structural and functional distinctions between MCR1 and other NADH-dependent reductases in C. glabrata center on substrate specificity, cellular localization, and regulatory mechanisms. MCR1 is specialized for electron transfer to cytochrome b5, while other reductases may interact with different electron acceptors. These distinctions can be investigated through: (1) Comparative structural analysis using X-ray crystallography or cryo-electron microscopy to identify unique binding pockets or active site configurations; (2) Protein-protein interaction studies using techniques such as bimolecular fluorescence complementation (BiFC) or pull-down assays to map the interactome of each reductase; (3) Subcellular fractionation coupled with activity assays to determine compartmentalization patterns; and (4) Systematic gene deletion studies comparing phenotypes when different reductases are eliminated. Research has demonstrated that alternative electron transport pathways, such as the cytochrome b5/NADH cytochrome b5 reductase system, can efficiently support CYP51-mediated reactions that are essential for ergosterol biosynthesis . This functional redundancy may contribute to antifungal resistance by providing metabolic flexibility when primary pathways are inhibited.

How does mitochondrial dysfunction affect MCR1 activity and related antifungal resistance mechanisms?

Mitochondrial dysfunction significantly impacts MCR1 activity and antifungal resistance through interconnected metabolic and signaling networks. Research has established that mitochondrial dysfunction acquired through mutations in mitochondrial or nuclear genes results in constitutively high Pdr1 activity and CDR1 expression, leading to fluconazole resistance and enhanced virulence . To study these relationships, researchers should employ: (1) Targeted disruption of specific mitochondrial processes using genetic approaches (knockout mutants of TCA cycle components like IDH2 and KGD2) to assess their impact on MCR1 expression and activity; (2) Metabolic flux analysis to track NADH/NAD+ ratios, as these directly affect MCR1 function; (3) Pharmacological approaches using mitochondrial inhibitors like oligomycin, which has been shown to activate Pdr1 and antagonize fluconazole efficacy by interfering with mitochondrial processes ; and (4) Transcriptomic and proteomic analyses comparing wild-type and mitochondrially compromised strains. The finding that transient mitochondrial dysfunction serves as an adaptive strategy for C. glabrata survival in fluconazole and within macrophage phagosomes suggests that MCR1-dependent pathways may be particularly important under conditions of mitochondrial stress .

What experimental approaches can effectively evaluate the contribution of MCR1 to the alternative electron transport pathway in sterol biosynthesis?

Evaluating MCR1's contribution to alternative electron transport in sterol biosynthesis requires a multi-faceted experimental approach. Researchers should implement: (1) Reconstitution experiments with purified components (MCR1, cytochrome b5, CYP51) to measure the efficiency of the complete electron transport chain in vitro, similar to studies demonstrating that fungal CYP51-mediated sterol 14α-demethylation can be wholly supported by the cytochrome b5/NADH cytochrome b5 reductase system ; (2) Gene deletion and complementation studies comparing sterol profiles in wild-type, mcr1Δ, and complemented strains using GC-MS or HPLC techniques; (3) Creation of strains with fluorescently tagged MCR1 and other pathway components to track their co-localization and dynamics during antifungal exposure; and (4) Metabolic labeling with isotope-tagged precursors to trace carbon flow through alternative pathways. Additionally, researchers should examine the kinetics of ergosterol biosynthesis under conditions where the primary NADPH cytochrome P450 reductase pathway is inhibited or deleted, which would reveal the quantitative contribution of the MCR1-dependent pathway to maintaining sterol homeostasis during stress.

How might the interaction between MCR1 and CIN5/YAP4 transcription factor influence antifungal susceptibility?

The interaction between MCR1 and the CIN5/YAP4 transcription factor represents a complex regulatory relationship with significant implications for antifungal susceptibility. CIN5/YAP4 has been identified as a bZIP transcription factor that represses mitochondrial genes in S. cerevisiae, and its deletion in C. glabrata results in enhanced mitochondrial activity and altered fluconazole susceptibility . To investigate this relationship, researchers should: (1) Perform chromatin immunoprecipitation sequencing (ChIP-seq) to determine if CIN5 directly regulates MCR1 expression; (2) Conduct epistasis analysis with mcr1Δ cin5Δ double mutants to assess whether MCR1 functions downstream of CIN5 in fluconazole resistance; (3) Compare the transcriptional profiles of wild-type and cin5Δ strains under different carbon sources to identify metabolic adaptations that might affect MCR1 function; and (4) Examine the natural variations in CIN5 and MCR1 across clinical isolates with different antifungal susceptibility profiles. The observation that CIN5 is naturally truncated in some C. glabrata clinical isolates (CBS138, DSY562) suggests evolutionary selection for altered mitochondrial regulation that may impact MCR1-dependent pathways . This potential regulatory relationship could provide new targets for combination therapies that disrupt both primary and alternative electron transport systems.

How can researchers accurately measure MCR1 activity in the context of antifungal resistance studies?

Accurately measuring MCR1 activity in antifungal resistance contexts requires methods that capture both enzymatic function and physiological relevance. Researchers should employ: (1) In vitro spectrophotometric assays measuring NADH consumption and cytochrome b5 reduction rates under varying substrate concentrations and in the presence of antifungal compounds; (2) Oxygen consumption measurements to assess the complete electron transport chain when coupled to oxygen-consuming CYP enzymes like CYP51; (3) In vivo reporter systems where fluorescent or luminescent proteins are expressed under the control of MCR1-dependent metabolic pathways; and (4) Metabolomic profiling of sterols and related compounds in strains with modified MCR1 expression or activity. When studying antifungal resistance, it's crucial to correlate enzymatic measurements with phenotypic assays such as minimum inhibitory concentration (MIC) determinations and time-kill curves. The finding that fungal CYP51-mediated sterol 14α-demethylation can be efficiently supported by the cytochrome b5/NADH cytochrome b5 reductase system highlights the importance of measuring this alternative pathway when evaluating resistance mechanisms .

What computational approaches are most effective for predicting MCR1 interactions with potential inhibitors?

Computational approaches for predicting MCR1 interactions with potential inhibitors should integrate structural biology, chemical informatics, and machine learning techniques. Researchers should implement: (1) Homology modeling of C. glabrata MCR1 based on known structures of related reductases, followed by molecular dynamics simulations to assess conformational flexibility; (2) Structure-based virtual screening using docking algorithms that account for protein flexibility and solvation effects; (3) Pharmacophore modeling based on known inhibitors of related NADH-dependent reductases; and (4) Quantum mechanical calculations to accurately represent electron transfer reactions at the active site. Machine learning approaches can enhance prediction accuracy by integrating data from multiple sources, including experimentally determined binding affinities, physiochemical properties, and structural features. High-throughput virtual screening methods similar to those used to identify inhibitors of CgCdr1 can be adapted for MCR1 targets. Studies should validate computational predictions through experimental binding assays and enzymatic inhibition studies, ideally with crystallographic confirmation of binding modes for lead compounds.

How might targeting MCR1-dependent pathways complement existing antifungal strategies?

Targeting MCR1-dependent pathways represents a promising strategy to complement existing antifungals by disrupting alternative metabolic routes that contribute to resistance. To develop this approach, researchers should: (1) Conduct combination studies testing MCR1 inhibitors with established antifungals to identify synergistic interactions, particularly with azoles that target ergosterol biosynthesis; (2) Evaluate the effect of MCR1 inhibition on virulence factors and stress response mechanisms in C. glabrata; (3) Develop selective inhibitors that target unique structural features of fungal MCR1 without affecting human homologs; and (4) Investigate the potential for MCR1 inhibitors to restore sensitivity in drug-resistant clinical isolates with activated PDR networks. The discovery that the cytochrome b5/NADH cytochrome b5 reductase system can wholly support CYP51-mediated reactions suggests that blocking this alternative pathway could enhance the efficacy of azole antifungals by preventing compensatory ergosterol synthesis. Additionally, the observation that mitochondrial dysfunction promotes both resistance and virulence indicates that targeting MCR1-dependent adaptation to mitochondrial stress could simultaneously address both treatment challenges.

What role might MCR1 play in the adaptation of C. glabrata to host microenvironments during infection?

MCR1 likely plays a significant role in C. glabrata's adaptation to diverse host microenvironments during infection through its involvement in maintaining metabolic flexibility. To investigate this role, researchers should: (1) Compare mcr1Δ and wild-type strains in infection models that recapitulate different host niches, including macrophage phagosomes where mitochondrial adaptation has been shown to be important for survival ; (2) Conduct transcriptomic and proteomic analyses of C. glabrata recovered from different infection sites to assess MCR1 expression patterns; (3) Evaluate the impact of host-relevant stresses (nutrient limitation, oxidative stress, pH changes) on MCR1 activity and contribution to fitness; and (4) Investigate potential interactions between MCR1-dependent metabolism and immune signaling pathways. The observation that transient mitochondrial dysfunction serves as an adaptive strategy for C. glabrata survival within macrophages suggests that MCR1 may contribute to persistence during immune surveillance. Understanding MCR1's role in host adaptation could reveal new vulnerabilities for therapeutic exploitation and explain patterns of tissue tropism or chronic colonization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.