Recombinant Candida glabrata Nuclear rim protein 1 (NUR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. Please inform us of your specific tag requirements for preferential development.
Synonyms
NUR1; CAGL0L07084g; Nuclear rim protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
NUR1
Target Protein Sequence
MFSWLIPDIPELFLTISVWFRLQGWEDNTKLGFIIGNTLTTIFYILRLAQDTLLAGVSRK LIRDYELFDLSKSETLLSDPAFSSYHDVLFNKHHSTANASSYNKRVRKVTSTVYWSTYFL LLLSCYTCYRLFNTYKVYRIYYLKDLNLDKHPSLKKIEPDYEVDEKLLKTSLKSKLLSRF IRLLQLQDEVETELPKVTEHYTLNKWDPSKLIISLSTSFSPTIIICLMYTNVTFLTVIPI IIHQGIFYFMIWNRYEERFKDDALLMRENYLQYDTKYVKPLKQIMYQDVMTDTATISDGG FTKFFPVSKSTLFKHHEMSGDVIIERYNKKSREFENVTDIIKPHHHINNTVKILPPTIRK DHKTNRYDHRQQSILKDRKFNIDSNEPQIINALTTAIPSRSFFNNNPSGSNDDNCSGIKV RSSPTRETFFPATPLRKK
Uniprot No.

Target Background

Function
NUR1 (Nuclear rim protein 1) is a component of a perinuclear network regulating recombination at multiple loci to ensure genomic stability. It plays a crucial role in maintaining rDNA repeat stability.
Database Links
Protein Families
NUR1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nuclear rim protein 1 (NUR1) in Candida glabrata and what is its significance?

Nuclear rim protein 1 (NUR1) is a protein encoded by the CAGL0L07084g gene in Candida glabrata. As its name suggests, NUR1 is localized to the nuclear envelope, where it likely plays a structural and functional role in maintaining nuclear integrity. The protein consists of 438 amino acids with a molecular architecture that suggests membrane association . While specific functions remain under investigation, its location at the nuclear rim indicates potential roles in nucleocytoplasmic transport, gene expression regulation, or chromatin organization. Understanding NUR1 is significant for characterizing fundamental biological processes in C. glabrata, which is an opportunistic fungal pathogen that has become increasingly relevant in clinical settings due to its antifungal resistance .

What expression systems are recommended for producing recombinant NUR1?

For optimal expression of recombinant C. glabrata NUR1, researchers should consider:

  • Prokaryotic systems: E. coli BL21(DE3) strains can be used for expression of partial domains, though full-length expression may be challenging due to potential membrane associations.

  • Eukaryotic systems: Yeast expression systems (particularly S. cerevisiae or Pichia pastoris) provide superior post-translational modifications and are recommended for full-length NUR1 production.

  • Expression constructs: Based on standard protocols for nuclear envelope proteins, expression vectors containing strong inducible promoters (GAL1 for yeast, T7 for E. coli) coupled with affinity tags (His6, GST, or MBP) at either N- or C-terminus facilitate purification.

The expression region from amino acids 1-438 should be included for full-length protein production, though domain-specific constructs may be appropriate depending on experimental goals .

What are the optimal storage conditions for preserving recombinant NUR1 activity?

Recombinant NUR1 requires specific storage conditions to maintain structural integrity and functional activity:

Storage ParameterRecommended ConditionNotes
Buffer compositionTris-based bufferTypically pH 7.5-8.0 for optimal stability
Glycerol content50%Prevents freeze-thaw damage
Temperature-20°C for short-term
-80°C for long-term
Avoid repeated freeze-thaw cycles
Working aliquotsStore at 4°CUse within one week

For optimal preservation, divide purified protein into single-use aliquots immediately after purification to prevent repeated freeze-thaw cycles, which significantly reduce protein activity. When thawing, maintain samples on ice and centrifuge briefly before use to remove any aggregates that may have formed during storage .

What purification strategies yield the highest purity of recombinant NUR1?

A multi-step purification approach is recommended for obtaining high-purity recombinant NUR1:

  • Initial capture: Affinity chromatography using the tag incorporated in the expression construct (Ni-NTA for His-tagged protein or glutathione-agarose for GST-fusion)

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve >95% purity

Detergent considerations are important if working with the full-length protein, as NUR1's nuclear membrane association may require mild detergents (0.1% DDM or 0.5% CHAPS) during extraction and initial purification steps. Purity should be assessed by SDS-PAGE and Western blotting using antibodies against the tag or NUR1-specific antibodies if available.

What methodological approaches are most effective for studying NUR1's interactions with other nuclear envelope components?

To characterize NUR1's interactome at the nuclear envelope, researchers should employ complementary approaches:

In vitro methods:

  • Affinity pull-down assays: Using recombinant tagged NUR1 as bait to capture interacting partners from C. glabrata nuclear extracts

  • Yeast two-hybrid screening: Split-ubiquitin Y2H systems are preferred for membrane-associated proteins like NUR1

  • Proximity-dependent labeling: BioID or APEX2 fusions with NUR1 to identify proximal proteins in vivo

In vivo methods:

  • Co-immunoprecipitation: Using antibodies against NUR1 (or its tag) followed by mass spectrometry

  • Fluorescence microscopy: FRET or BiFC assays to validate direct interactions in living cells

  • ChIP-seq: If NUR1 associates with chromatin, to identify genomic regions of interaction

Data integration approaches:

  • Cross-reference interactome data with available datasets from other nuclear envelope proteins

  • Apply weighted network analysis to identify high-confidence interactions

  • Validate key interactions through reciprocal pull-downs and functional assays

These approaches should be conducted under different growth conditions, including stress conditions that mimic host environments, to capture context-dependent interactions that may be relevant to C. glabrata pathogenicity.

How can researchers effectively use NUR1 to study C. glabrata nuclear organization during infection?

Studying nuclear organization during infection presents technical challenges that can be addressed through the following methodological approaches:

  • Fluorescent tagging: Generate C. glabrata strains expressing NUR1-fluorescent protein fusions (e.g., GFP, mCherry) under native promoter control to monitor nuclear envelope dynamics without disrupting function

  • Ex vivo imaging: Recover C. glabrata cells from infection models (such as G. mellonella hemocytes or macrophage co-culture systems) and analyze nuclear morphology changes using super-resolution microscopy

  • Chromatin conformation analysis: Utilize proximity ligation techniques (3C, Hi-C) on NUR1-associated chromatin to map infection-induced changes in genome organization

  • Correlative approaches: Combine live cell imaging with electron microscopy (CLEM) to connect nuclear ultrastructure to NUR1 distribution during host-pathogen interaction

  • Quantitative image analysis pipeline:

Analysis ParameterMethodExpected Outcome
Nuclear morphologyAutomated segmentationDetect stress-induced nuclear alterations
NUR1 distributionIntensity profilingMap redistribution during infection
Chromatin contactsFISH or Hi-CIdentify infection-specific genome reorganization
DynamicsFRAP or SPTMeasure NUR1 mobility changes during stress

This multi-faceted approach can connect NUR1 function to nuclear reorganization events that may influence virulence gene expression during host adaptation, similar to mechanisms observed with other virulence determinants in C. glabrata .

What is known about post-translational modifications of NUR1 and their functional significance?

Post-translational modifications (PTMs) likely play critical roles in regulating NUR1 function, though specific studies on NUR1 PTMs are currently limited. Based on sequence analysis and comparison with other nuclear envelope proteins, researchers should investigate:

  • Phosphorylation: Analysis of the NUR1 sequence reveals potential serine/threonine phosphorylation sites, particularly in regions predicted to face the nucleoplasm. These modifications may regulate protein-protein interactions or response to stress conditions.

  • SUMOylation: Nuclear envelope proteins are frequent targets of SUMOylation, which can alter protein localization and function. Consensus SUMO-attachment motifs should be analyzed in the NUR1 sequence.

  • Methodology for PTM identification:

    • Mass spectrometry-based phosphoproteomics under different stress conditions

    • Site-directed mutagenesis of predicted modification sites followed by functional assays

    • Immunoprecipitation with PTM-specific antibodies (anti-phospho, anti-SUMO)

  • Physiological relevance: PTM patterns may change during exposure to host defense mechanisms, potentially altering NUR1's interactions with chromatin or other nuclear components.

A systematic investigation of NUR1 PTMs would provide insights into regulatory mechanisms that may connect environmental sensing to nuclear functions during host-pathogen interactions.

What are the most informative phenotypic assays for studying NUR1 knockout mutants?

When characterizing NUR1 knockout mutants in C. glabrata, researchers should employ a multi-tiered phenotypic analysis approach:

Growth and stress response assays:

  • Growth kinetics in normal and stress conditions (oxidative, pH, osmotic stress)

  • Survival assays in the presence of phagocytes

  • Resistance to antifungal compounds

Cell biology phenotypes:

  • Nuclear morphology and integrity assessment

  • Nuclear pore complex distribution

  • Chromatin organization using DNA staining and immunofluorescence

Infection model analyses:

  • G. mellonella infection survival curves (modeled after CgDtr1 studies)

  • Proliferation assessment in hemolymph at different time points

  • Resistance to hemocyte killing

Based on findings with other C. glabrata virulence factors, particular attention should be paid to the 48-hour time point in infection models, as this appears to be critical for observing differences in proliferation capacity . When designing these experiments, include appropriate controls such as wild-type strains and complemented mutants to confirm phenotype specificity.

How can researchers effectively develop and validate antibodies against NUR1 for immunological studies?

Developing specific antibodies against NUR1 requires careful epitope selection and validation strategies:

Epitope selection approach:

  • Analyze the NUR1 sequence for hydrophilic, surface-exposed regions with high predicted antigenicity

  • Focus on unique regions with low homology to other C. glabrata proteins or host proteins

  • Consider producing antibodies against multiple epitopes to increase detection options

Production strategies:

  • Peptide antibodies: Synthesize 15-20 amino acid peptides from selected epitopes

  • Recombinant fragment antibodies: Express immunogenic domains (avoiding transmembrane regions)

Comprehensive validation protocol:

  • Western blot analysis using wild-type and NUR1 knockout C. glabrata lysates

  • Immunofluorescence microscopy comparing localization patterns in wild-type vs. knockout

  • Immunoprecipitation followed by mass spectrometry to confirm specificity

Application-specific validation:

  • For ELISA applications: Establish detection limits using purified recombinant protein

  • For ChIP applications: Validate using spike-in controls and known targets

A well-validated NUR1 antibody will serve as a valuable tool for various applications including protein localization studies, interaction analyses, and quantification of expression levels across different conditions or clinical isolates.

What data analysis approaches are recommended for interpreting NUR1 functional genomics experiments?

When conducting functional genomics studies involving NUR1, the following analytical framework is recommended:

RNA-seq data analysis pipeline:

  • Quality control and normalization specific to fungal transcriptomes

  • Differential expression analysis between wild-type and NUR1 mutants

  • Gene set enrichment analysis focusing on stress response and virulence pathways

  • Co-expression network analysis to identify NUR1-dependent gene modules

ChIP-seq analysis strategy:

  • Peak calling using algorithms optimized for nuclear envelope proteins

  • Integration with gene expression data to connect binding to regulatory outcomes

  • Motif analysis to identify potential DNA binding preferences

  • Comparison with chromatin accessibility data (ATAC-seq)

Comparative analysis approach:

  • Cross-species comparison with homologous proteins in other Candida species

  • Cross-referencing with datasets from studies of other virulence factors (e.g., CgDtr1)

  • Integration with host response data to identify host-pathogen interaction points

The interpretation should consider the potential role of NUR1 in regulating gene expression programs related to stress response and virulence, similar to how other factors like CgDtr1 influence C. glabrata's ability to proliferate within host environments and resist stressors encountered during infection .

What are the major technical challenges in studying NUR1 function and how can they be addressed?

Researchers face several technical challenges when investigating NUR1:

Challenge 1: Protein solubility and purification

  • Nuclear envelope proteins often contain hydrophobic regions that complicate purification

  • Solution: Employ fusion tags that enhance solubility (MBP, SUMO) or develop domain-specific constructs that avoid transmembrane regions

Challenge 2: Functional redundancy

  • Nuclear envelope proteins frequently have overlapping functions

  • Solution: Develop double or triple knockout approaches targeting potential redundant factors; use conditional depletion systems for essential combinations

Challenge 3: In vivo visualization

  • The nuclear envelope is a crowded environment making specific visualization difficult

  • Solution: Implement super-resolution microscopy techniques (PALM/STORM, SIM) with optimized fluorophores for fungal cell imaging

Challenge 4: Relevance to infection

  • Connecting molecular mechanisms to in vivo infection outcomes

  • Solution: Develop ex vivo systems that better mimic host environments while remaining experimentally accessible; implement real-time imaging in simplified infection models

By addressing these challenges through innovative methodological approaches, researchers can more effectively elucidate NUR1's functions in C. glabrata biology and pathogenesis.

How does NUR1 compare to similar proteins in other pathogenic Candida species, and what are the implications for antifungal research?

Comparative analysis of NUR1 across Candida species provides important insights:

SpeciesHomolog IdentityKey Structural DifferencesFunctional Implications
C. albicans~45-55% (predicted)Extended loop regionsPotentially different interactome
C. parapsilosis~40-50% (predicted)Variable N-terminusSpecies-specific regulation
C. auris~35-45% (predicted)More hydrophobic regionsDifferent membrane integration

These differences may contribute to species-specific virulence mechanisms and antifungal susceptibility profiles. The nuclear envelope represents an underexplored target for antifungal development, with proteins like NUR1 potentially offering species-specific intervention points.

Research implications include:

  • Developing compounds that disrupt NUR1-specific functions in C. glabrata

  • Investigating whether nuclear envelope disruption can sensitize C. glabrata to existing antifungals

  • Exploring whether differences in nuclear envelope composition contribute to the distinctive antifungal resistance profiles of C. glabrata

Similar to how transporter proteins like CgDtr1 contribute to stress resistance and virulence , nuclear envelope components may play crucial roles in C. glabrata's ability to adapt to host environments and antifungal challenges.

What experimental approaches can link NUR1 function to clinical outcomes in C. glabrata infections?

To establish clinical relevance of NUR1 research, investigators should pursue:

  • Clinical isolate analysis:

    • Sequence NUR1 across clinical isolates with varying virulence/resistance profiles

    • Correlate NUR1 variants with treatment outcomes and infection persistence

    • Assess NUR1 expression levels in isolates before and after antifungal treatment

  • Translational models:

    • Extend beyond G. mellonella to murine models of candidiasis

    • Compare colonization, dissemination, and organ burden between wild-type and NUR1 mutants

    • Evaluate NUR1 mutant fitness in the context of antifungal therapy

  • Ex vivo human systems:

    • Utilize human immune cell co-culture systems to assess NUR1's impact on immune evasion

    • Develop organoid models to study tissue-specific interactions

  • Biomarker potential:

    • Assess whether anti-NUR1 antibodies are present in patients with C. glabrata infections

    • Evaluate NUR1 fragments as potential diagnostic biomarkers

These approaches can bridge fundamental research on NUR1 to clinical applications, potentially identifying new therapeutic strategies or diagnostic tools for C. glabrata infections, which are becoming increasingly problematic due to antifungal resistance . Similar translational approaches have revealed the importance of other C. glabrata factors in infection contexts .

What are the most promising future research directions for NUR1 investigations?

Based on current knowledge and gaps, the following research directions for NUR1 show particular promise:

  • Structural biology approaches:

    • Cryo-EM studies of NUR1 in the context of the nuclear envelope

    • Structural determination of key domains to enable rational inhibitor design

  • Systems biology integration:

    • Multi-omics approaches connecting NUR1 to global cellular responses during infection

    • Network analyses positioning NUR1 within stress response and virulence pathways

  • Host-pathogen interface studies:

    • Investigation of how host immune factors influence NUR1 function

    • Analysis of nuclear reorganization during immune cell interactions

  • Evolutionary perspectives:

    • Comparative analyses across Candida species to understand how nuclear envelope specialization contributes to niche adaptation

    • Identification of conserved vs. species-specific functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.