Recombinant Candida glabrata Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Overview

PFA4 belongs to the DHHC (Asp-His-His-Cys) palmitoyltransferase family, mediating reversible palmitate addition to target proteins. This modification regulates membrane association, protein stability, and cellular signaling . The recombinant version is produced via heterologous expression in E. coli or yeast systems, enabling controlled studies of its enzymatic activity and substrate specificity .

Source:

Functional Role and Interaction Partners

PFA4 catalyzes palmitoylation of cysteine residues, influencing protein trafficking and membrane dynamics. Key functional partners include:

ProteinFunctionInteraction Score
AKR1Palmitoyltransferase specific for casein kinase 10.783
VAC8Vacuolar protein involved in membrane trafficking and protein targeting0.672
SWF1Targets endosomal SNAREs; regulates transmembrane protein quality control0.608
PFA3Palmitoylates VAC8 at N-terminal cysteine residues0.502
TPI1Triosephosphate isomerase (metabolic enzyme)0.448

Source:

Recombinant Production and Applications

Commercially available recombinant PFA4 is optimized for enzymatic assays and structural studies.

Research Applications

  1. Enzymatic Assays: Testing substrate specificity (e.g., palmitoylation of SNAREs or vacuolar proteins).

  2. Structural Studies: Crystallography or NMR to map interaction sites with AKR1, VAC8, or SWF1 .

  3. Pathway Analysis: Investigating cross-talk between palmitoylation and vacuolar trafficking in C. glabrata .

Comparative Analysis of Recombinant Variants

Partial and full-length variants are available, differing in coverage and utility:

VariantCoverageHostPurityUse Case
Full-Length (1–376)CompleteE. coli>90%Enzymatic activity, structural studies
PartialTruncatedS. cerevisiae≥85%Substrate binding assays

Source:

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
PFA4; CAGL0E02497g; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
PFA4
Target Protein Sequence
MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSEWLN DWGESLEDFGVDVDVE
Uniprot No.

Target Background

Function
This recombinant *Candida glabrata* palmitoyltransferase PFA4 (PFA4) mediates the reversible addition of palmitate to target proteins, thereby regulating their membrane association and biological function.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Candida glabrata Palmitoyltransferase PFA4 and what is its biological function?

Candida glabrata Palmitoyltransferase PFA4 (UniProt ID: Q6FVE6) is a protein S-acyltransferase (PAT) that catalyzes the addition of palmitate, a 16-carbon fatty acid, to specific cysteine residues of target proteins through a thioester bond. This post-translational modification, known as S-palmitoylation, is reversible and plays critical roles in:

  • Protein membrane association and trafficking

  • Protein stability and conformation

  • Subcellular localization of target proteins

  • Protein-protein interactions

Like other members of the DHHC family of PATs, PFA4 is characterized by a conserved Asp-His-His-Cys (DHHC) motif within a cysteine-rich domain that is essential for its catalytic activity. In pathogenic fungi like C. glabrata, palmitoylation is increasingly recognized as important for virulence factor function and host-pathogen interactions .

What are the recommended expression and purification methods for recombinant PFA4?

Recombinant full-length C. glabrata PFA4 (376 amino acids) can be successfully expressed in E. coli with an N-terminal His-tag for purification purposes . The recommended methodology includes:

Expression system:

  • E. coli strain optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Vector containing an N-terminal His-tag

  • IPTG-inducible promoter system

  • Expression at lower temperatures (16-20°C) to facilitate proper folding

Purification protocol:

  • Cell lysis using detergent-based methods to solubilize membrane proteins

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification

  • Addition of detergents (e.g., DDM, CHAPS) throughout purification to maintain protein solubility

Quality control:

  • SDS-PAGE analysis for purity (>90% recommended)

  • Western blot using anti-His antibodies for identity confirmation

  • Activity assays to verify functional integrity

What are the optimal storage conditions for maintaining PFA4 stability and activity?

To maintain protein stability and preserve the enzymatic activity of recombinant PFA4, the following storage conditions are recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution in deionized sterile water (concentration 0.1-1.0 mg/mL), add glycerol to a final concentration of 50%

  • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C

  • Use Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for optimal stability

  • Avoid repeated freeze-thaw cycles as they significantly reduce activity

How can researchers verify the enzymatic activity of recombinant PFA4?

Verification of PFA4 enzymatic activity can be performed using several complementary methods:

Metabolic labeling approach:

  • Incubate recombinant PFA4 with candidate substrate proteins and [³H]palmitate or alkyne-palmitate

  • Allow reaction to proceed at 30°C for 30-60 minutes

  • Detect labeled proteins via fluorography (for radioactive palmitate) or click chemistry (for alkyne-palmitate)

  • Quantify incorporation of palmitate using scintillation counting or densitometry analysis

Acyl-biotin exchange (ABE) assay:

  • Block free thiols with N-ethylmaleimide (NEM)

  • Treat with hydroxylamine to cleave thioester bonds

  • Label newly exposed thiols with biotin-BMCC

  • Detect biotinylated proteins by Western blotting with streptavidin-HRP

Acyl-RAC (resin-assisted capture) method:

  • Treat samples with hydroxylamine to cleave thioester bonds

  • Capture newly exposed thiols on thiopropyl sepharose

  • Elute bound proteins and analyze by Western blotting

These methods allow for both qualitative confirmation of palmitoyltransferase activity and quantitative measurement of substrate specificity and kinetic parameters.

How can researchers apply site-directed mutagenesis to study PFA4 catalytic mechanisms?

Site-directed mutagenesis provides powerful insights into PFA4's structure-function relationships. A comprehensive approach includes:

Key residues for mutation analysis:

  • DHHC catalytic domain: Mutate the conserved cysteine in the DHHC motif (cysteine to serine) to abolish catalytic activity

  • Transmembrane domains: Target conserved residues in TM domains to analyze membrane integration

  • N-terminal and C-terminal domains: Introduce mutations or truncations to assess regulatory functions

Experimental workflow:

  • Mutagenesis protocol:

    • Design primers incorporating desired mutations

    • Perform PCR-based site-directed mutagenesis

    • Verify mutations by sequencing

  • Expression and purification:

    • Express wild-type and mutant proteins under identical conditions

    • Purify using standardized protocols for direct comparison

  • Functional characterization:

    Mutation TypeExpected OutcomeAnalytical Method
    DHHC motifLoss of palmitoyltransferase activityABE assay, metabolic labeling
    Transmembrane domainsAltered membrane localizationSubcellular fractionation, fluorescence microscopy
    Regulatory domainsChanged substrate specificitySubstrate profiling assays
  • Structure analysis:

    • Compare wild-type and mutant protein structures using circular dichroism or thermal stability assays

    • Assess impact on protein-protein interactions using co-immunoprecipitation

  • In vivo validation:

    • Introduce mutations into genomic PFA4 in C. glabrata

    • Evaluate effects on cellular processes and virulence

This systematic approach will delineate the roles of specific residues in catalysis, substrate recognition, and regulatory interactions, advancing understanding of PFA4's molecular mechanism .

What approaches can be used to identify and validate PFA4 substrates in Candida glabrata?

Identification and validation of PFA4 substrates requires a multi-faceted approach combining proteomics, genetics, and biochemical validation:

Global substrate identification:

  • Comparative proteomics:

    • Compare palmitoylated proteomes in wild-type vs. PFA4 deletion strains using acyl-biotin exchange (ABE) coupled with mass spectrometry

    • Proteins with decreased palmitoylation in deletion strains represent potential substrates

  • Metabolic labeling:

    • Treat cells with alkyne-palmitate followed by click chemistry and enrichment

    • Compare labeled proteins between wild-type and PFA4 deletion strains

  • Proximity labeling:

    • Express PFA4 fused to a promiscuous biotin ligase (BioID or TurboID)

    • Identify biotinylated proteins that interact with PFA4

Substrate validation:

  • In vitro palmitoylation assays:

    • Express and purify candidate substrates

    • Incubate with recombinant PFA4 and [³H]palmitate

    • Detect incorporation by fluorography

  • Site identification:

    • Perform mass spectrometry to identify specific palmitoylated cysteines

    • Create cysteine-to-serine mutants to confirm palmitoylation sites

    • Assess functional consequences of preventing palmitoylation

  • Functional studies:

    • Assess localization changes using fluorescent protein fusions

    • Evaluate protein-protein interactions with and without palmitoylation

    • Determine impact on virulence-related phenotypes

This integrated approach will generate a comprehensive map of PFA4 substrates and their roles in C. glabrata pathogenicity.

How does PFA4 compare to homologous proteins in other pathogenic Candida species?

A comparative analysis of PFA4 across Candida species reveals important evolutionary insights and functional conservation:

Sequence and structure comparison:

SpeciesProteinIdentity to CgPFA4Key Structural Differences
C. glabrataPFA4100%Reference sequence
C. albicansPFA4~60-65% (estimated)Extended N-terminal domain
C. parapsilosisPFA4~55-60% (estimated)Variable cysteine-rich domain
S. cerevisiaePFA4~70-75% (estimated)High conservation in DHHC domain

Functional comparison:

  • All homologs share the core DHHC palmitoyltransferase domain

  • Differences in substrate specificity likely correlate with species-specific virulence mechanisms

  • Variation in regulatory domains may reflect adaptation to different host environments

Evolutionary significance:

  • Phylogenetic analysis places C. glabrata PFA4 closer to S. cerevisiae than to other Candida species, consistent with whole-genome phylogeny

  • Conservation of PFA4 across pathogenic yeasts suggests important roles in fungal physiology and possibly virulence

Research applications:

  • Heterologous expression systems can test functional complementation between species

  • Chimeric proteins can identify domains responsible for substrate specificity differences

  • Targeting conserved vs. divergent regions has implications for antifungal drug development

This comparative approach provides context for understanding PFA4's specialized functions in C. glabrata virulence.

What role might PFA4 play in Candida glabrata biofilm formation and drug resistance?

Biofilm formation represents a major virulence determinant in C. glabrata infections, conferring enhanced resistance to antifungal agents and host immune defenses. PFA4 likely contributes to this process through several mechanisms:

Potential contributions to biofilm development:

  • Adhesin regulation: Palmitoylation may control the function and localization of cell surface adhesins required for initial attachment to surfaces and cell-cell interactions within the biofilm matrix.

  • Extracellular matrix production: PFA4 might regulate proteins involved in extracellular polymeric substance (EPS) synthesis and secretion, critical components of mature biofilms.

  • Stress response coordination: Similar to how CgDtr1 mediates acetic acid stress resistance , PFA4-dependent palmitoylation may regulate stress response proteins that enable survival in the harsh microenvironment of biofilms.

  • Transport and secretion mechanisms: Palmitoylation could control transporters involved in nutrient acquisition and waste removal within biofilm structures.

Experimental approaches to investigate PFA4 in biofilms:

  • Biofilm formation assays:

    • Compare biofilm formation in wild-type vs. PFA4 deletion strains using crystal violet staining and confocal microscopy

    • Assess biomass, thickness, and architecture of biofilms

  • Transcriptional profiling:

    • Perform RNA-seq comparing planktonic and biofilm cells with and without PFA4

    • Identify biofilm-specific genes regulated by PFA4

  • Antifungal susceptibility:

    • Determine minimum inhibitory concentrations (MICs) for various antifungals against biofilms formed by wild-type and PFA4 mutant strains

    • Assess survival after antifungal treatment

  • Mixed-species interactions:

    • Evaluate how PFA4 affects C. glabrata interactions with C. albicans in mixed biofilms, potentially through mechanisms similar to those described for the Yhi1 protein

Understanding PFA4's role in biofilm formation could reveal novel targets for therapeutic intervention in C. glabrata infections .

What are the best practices for designing inhibitors targeting C. glabrata PFA4?

Designing effective inhibitors against C. glabrata PFA4 requires a strategic approach considering both the protein's structure and the need for selective targeting:

Target-based inhibitor design strategy:

  • Structure-based approaches:

    • Homology modeling of PFA4 based on related DHHC-palmitoyltransferases

    • Virtual screening of compound libraries against the DHHC active site

    • Fragment-based screening to identify initial binding scaffolds

    • Structure-activity relationship (SAR) studies to optimize lead compounds

  • Active site targeting:

    • Design competitive inhibitors that mimic the acyl-CoA substrate

    • Develop covalent inhibitors targeting the catalytic cysteine in the DHHC motif

    • Create transition-state analogs that mimic the thioester transfer reaction

  • Allosteric inhibitor development:

    • Identify regulatory sites outside the active site

    • Design compounds that disrupt protein-protein interactions essential for function

    • Target species-specific regulatory domains

Selectivity considerations:

  • Fungal vs. human selectivity:

    • Compare PFA4 with human DHHC proteins to identify structural differences

    • Target fungal-specific features to minimize off-target effects

    • Design compounds that exploit differences in membrane environment

  • Screening cascade:

    Screening StageAssay TypePurpose
    PrimaryBiochemical assay with recombinant PFA4Identify compounds with basic inhibitory activity
    SecondaryCell-based assays in C. glabrataConfirm membrane permeability and efficacy
    TertiaryCounter-screening against human DHHC proteinsAssess selectivity
    AdvancedBiofilm inhibition assaysEvaluate efficacy against clinically relevant forms
  • Combination strategies:

    • Test PFA4 inhibitors in combination with existing antifungals

    • Evaluate synergistic effects, particularly against biofilm formation

This systematic approach to inhibitor design could yield novel therapeutic agents with activity against drug-resistant C. glabrata strains.

How can researchers utilize recombinant PFA4 in high-throughput screening assays?

Developing effective high-throughput screening (HTS) assays for recombinant PFA4 requires optimization of protein production, assay design, and data analysis:

Optimized protein production for HTS:

  • Expression system refinement:

    • Develop a stable cell line for consistent protein quality

    • Optimize culture conditions for maximum yield and activity

    • Implement batch validation protocols to ensure consistency

  • Purification streamlining:

    • Automate purification steps using liquid handling systems

    • Implement quality control checkpoints to ensure batch-to-batch reproducibility

    • Develop storage protocols that maintain activity over time

HTS assay development:

  • Fluorescence-based activity assays:

    • Develop fluorogenic peptide substrates containing cysteines that change fluorescence upon palmitoylation

    • Optimize signal-to-background ratio for 384- or 1536-well plate formats

    • Validate with known inhibitors and activators

  • Alternative assay formats:

    • FRET-based assays measuring conformational changes upon substrate binding

    • SPA (scintillation proximity assay) using radiolabeled palmitoyl-CoA

    • AlphaScreen-based detection of palmitoylated products

  • Assay optimization parameters:

    ParameterOptimization ApproachAcceptance Criteria
    Z'-factorAdjust reagent concentrations and incubation timesZ' > 0.5
    Signal windowOptimize enzyme and substrate concentrationsS/B > 3
    DMSO toleranceTest increasing DMSO concentrations<20% activity loss at 1% DMSO
    Kinetic parametersDetermine Km values for substratesAssay run at Km concentrations

Data analysis and hit validation:

  • Primary screening analysis:

    • Implement plate normalization methods

    • Apply statistical thresholds for hit identification (typically >30% inhibition)

    • Flag compounds with known assay interference patterns

  • Confirmation cascade:

    • Dose-response curves with fresh compounds

    • Orthogonal assays to eliminate false positives

    • Counter-screens against related enzymes to assess selectivity

  • Hit characterization:

    • Determine mechanism of inhibition

    • Assess effects on C. glabrata growth and virulence

    • Evaluate activity against biofilms

This comprehensive HTS approach will enable efficient identification of compounds targeting PFA4 with potential therapeutic applications.

What are the recommended methods for studying PFA4 localization and trafficking in live cells?

Investigating the subcellular localization and trafficking dynamics of PFA4 in live C. glabrata cells requires specialized approaches that preserve protein function while enabling visualization:

Fluorescent protein fusion strategies:

  • Construct design considerations:

    • C-terminal GFP fusions are generally preferable to avoid disrupting N-terminal membrane insertion sequences

    • Include flexible linkers (e.g., GGGGS) between PFA4 and fluorescent protein

    • Create both genomic integrations and plasmid-based expressions for complementary analyses

    • Validate functionality of fusion proteins through complementation assays

  • Live-cell imaging techniques:

    • Confocal microscopy for high-resolution static imaging

    • Spinning disk confocal for dynamic trafficking studies

    • TIRF microscopy for analyzing plasma membrane localization

    • Super-resolution techniques (STORM, PALM) for nanoscale organization

  • Co-localization studies:

    • Combine with organelle markers (ER, Golgi, plasma membrane, endosomes)

    • Use multi-color imaging to track PFA4 relative to its substrates

    • Quantify co-localization using Pearson's or Mander's coefficients

Advanced trafficking studies:

  • Photoactivatable/photoconvertible approaches:

    • Fuse PFA4 to photoactivatable GFP or mEos proteins

    • Activate fluorescence in specific cellular regions

    • Track protein movement over time to measure trafficking kinetics

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Bleach fluorescently tagged PFA4 in specific cellular regions

    • Measure fluorescence recovery to determine mobility and membrane dynamics

    • Calculate diffusion coefficients and immobile fractions

  • Perturbation approaches:

    • Apply inhibitors of various trafficking pathways to determine PFA4 routing

    • Use temperature shifts to block specific vesicular transport steps

    • Create mutations in trafficking motifs to identify regulatory sequences

Experimental design for C. glabrata cells:

Based on previous localization studies of membrane proteins in C. glabrata, such as CgDtr1 which was shown to localize to the plasma membrane, similar approaches can be applied to PFA4 :

  • Express PFA4-GFP fusion proteins in C. glabrata cells

  • Verify expression and functionality through Western blotting and complementation assays

  • Image live cells using confocal microscopy with appropriate controls

  • Perform quantitative analysis of localization patterns under various conditions

This approach has been successfully applied to other C. glabrata membrane proteins and would be suitable for PFA4 localization studies .

How does PFA4 function integrate with other virulence mechanisms in C. glabrata pathogenesis?

C. glabrata employs multiple coordinated virulence mechanisms to establish infection, and PFA4 likely serves as a regulatory node within this complex network:

Integration with known virulence pathways:

  • Nutrient acquisition systems:

    • PFA4 may palmitoylate membrane transporters like CgDtr1, which functions as an acetate exporter essential for proliferation in host environments

    • This palmitoylation could regulate transporter localization, stability, or activity

  • Stress response coordination:

    • Similar to how CgDtr1 provides resistance to oxidative stress, PFA4-mediated palmitoylation likely modulates stress response proteins

    • Palmitoylation can affect protein compartmentalization during stress responses

  • Host immune evasion:

    • PFA4 may modify proteins involved in resistance to antimicrobial peptides, similar to CgTpo4's role in histatin-5 resistance

    • Palmitoylation could regulate surface proteins involved in immune recognition

  • Interspecies interactions:

    • In mixed Candida infections, PFA4 might contribute to regulatory processes similar to those involving Yhi1, which mediates interactions between C. glabrata and C. albicans

Experimental frameworks to study integration:

  • Systems biology approaches:

    • Transcriptomics comparing wild-type and PFA4 deletion strains under infection-relevant conditions

    • Proteomics to identify changes in the palmitoylome upon exposure to host stresses

    • Network analysis to position PFA4 within virulence signaling pathways

  • Genetic interaction studies:

    • Create double mutants of PFA4 with other virulence genes (e.g., PFA4/CgDTR1 or PFA4/CgTPO4)

    • Assess synthetic phenotypes in virulence assays

    • Use epistasis analysis to determine pathway relationships

  • Host-pathogen interaction models:

    • Compare wild-type and PFA4 mutant behavior in phagocytosis assays

    • Assess proliferation in models like G. mellonella hemolymph, similar to studies with CgDtr1

    • Evaluate survival within mammalian macrophages

Understanding these integrative functions will provide a more complete picture of C. glabrata pathogenesis and identify potential points for therapeutic intervention.

What are the challenges and solutions for expressing membrane-associated proteins like PFA4?

Membrane proteins like PFA4 present significant challenges for recombinant expression and purification. Understanding these challenges and implementing effective solutions is critical for successful functional studies:

Key challenges and targeted solutions:

  • Protein misfolding and aggregation:

    • Challenge: Hydrophobic transmembrane domains often misfold or aggregate during expression

    • Solutions:

      • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

      • Express at lower temperatures (16-20°C) to slow folding and prevent aggregation

      • Add chemical chaperones like glycerol or sucrose to culture media

      • Consider fusion partners like MBP or SUMO that enhance solubility

  • Toxicity to expression hosts:

    • Challenge: Overexpression of membrane proteins can disrupt host membrane integrity

    • Solutions:

      • Use tightly controlled inducible promoters (e.g., pBAD, T7lac)

      • Implement low-level induction strategies with reduced inducer concentrations

      • Consider cell-free expression systems for highly toxic proteins

      • Use insect or mammalian cells for difficult targets

  • Protein extraction and stability:

    • Challenge: Maintaining native conformation during extraction from membranes

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, CHAPS) for optimal extraction

      • Use detergent mixtures or newer amphipols for increased stability

      • Add lipids during purification to stabilize native conformations

      • Consider nanodiscs or liposomes for reconstitution

  • Purification complications:

    • Challenge: Detergent micelles can interfere with binding to chromatography resins

    • Solutions:

      • Optimize detergent concentration to minimize micelle size

      • Use detergent-resistant affinity tags (His10 instead of His6)

      • Implement specialized purification protocols with pre-equilibrated resins

      • Consider on-column detergent exchange during purification

Experimental workflow for PFA4:

StageOptimization ParametersQuality Control
Vector designTag position, promoter strengthSequence verification
Expression screeningTemperature, induction time, media compositionWestern blotting
Membrane extractionDetergent type, concentration, extraction timeActivity assays
PurificationBuffer composition, pH, salt concentrationSDS-PAGE, size exclusion chromatography
StabilizationLipid addition, protein concentrationThermal stability assays

By systematically addressing these challenges, researchers can obtain functional recombinant PFA4 suitable for structural and biochemical studies .

What emerging technologies might advance our understanding of PFA4 function and regulation?

Several cutting-edge technologies are poised to revolutionize our understanding of PFA4 and other palmitoyltransferases in C. glabrata:

Structural biology breakthroughs:

  • Cryo-electron microscopy (Cryo-EM):

    • Recent advances in single-particle cryo-EM now enable high-resolution structures of membrane proteins

    • Application to PFA4 could reveal substrate binding mechanisms and conformational changes during catalysis

    • Time-resolved cryo-EM could capture intermediate states in the palmitoylation reaction

  • Integrative structural approaches:

    • Combining X-ray crystallography, cryo-EM, and NMR spectroscopy

    • Molecular dynamics simulations informed by experimental structures

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

Genome engineering technologies:

  • CRISPR-Cas9 applications:

    • Precise genome editing to create point mutations in endogenous PFA4

    • High-throughput screening of PFA4 variants using CRISPR libraries

    • CRISPRi/CRISPRa systems for tunable repression or activation of PFA4 expression

  • Base editing and prime editing:

    • Introduction of specific mutations without double-strand breaks

    • Systematic alteration of catalytic residues to probe function

    • Engineering substrate specificity by targeted mutagenesis

Advanced imaging techniques:

  • Super-resolution microscopy:

    • Visualize nanoscale organization of PFA4 in cellular membranes

    • Track single molecules of PFA4 to understand dynamics

    • Correlative light and electron microscopy to link function with ultrastructure

  • Proximity labeling technologies:

    • BioID or TurboID fusions to map PFA4 interaction networks

    • Enzyme-catalyzed proximity labeling to identify transient interactions

    • Spatially-resolved proteomics to map PFA4 substrates in specific cellular compartments

High-throughput functional genomics:

  • Palmitoylome profiling:

    • Click chemistry-based proteomic approaches for comprehensive palmitoylome analysis

    • Quantitative proteomics comparing wild-type and PFA4 mutant strains

    • Integrating palmitoylome data with other post-translational modifications

  • Synthetic biology approaches:

    • Creation of minimal palmitoyltransferase systems

    • Engineering PFA4 with novel substrate specificity or regulation

    • Development of optogenetic tools to control PFA4 activity with light

These emerging technologies will enable unprecedented insights into PFA4 function and potentially reveal new strategies for therapeutic intervention in C. glabrata infections.

How might PFA4 research contribute to developing novel antifungal strategies?

Research on C. glabrata PFA4 holds significant promise for innovative antifungal therapeutic approaches, particularly against drug-resistant infections:

Therapeutic targeting strategies:

  • Direct enzyme inhibition:

    • Development of small molecule inhibitors targeting PFA4 catalytic activity

    • Design of peptidomimetics that compete with substrate binding

    • Creation of covalent inhibitors targeting the catalytic cysteine residue

  • Substrate interface disruption:

    • Identification of key protein-protein interaction surfaces

    • Design of peptides or small molecules that prevent substrate recruitment

    • Allosteric modulators that alter PFA4 conformation

  • Regulatory circuit interference:

    • Targeting upstream regulators of PFA4 expression

    • Modulating feedback mechanisms controlling PFA4 activity

    • Disrupting localization of PFA4 to functional cellular compartments

Potential advantages of PFA4-based approaches:

  • Novel mechanism of action:

    • Targeting protein palmitoylation represents a pathway distinct from current antifungals

    • Potential to overcome existing resistance mechanisms

    • Opportunity for combination therapies with synergistic effects

  • Specificity opportunities:

    • Structural differences between fungal and human palmitoyltransferases can be exploited

    • Tissue-specific delivery systems could minimize off-target effects

    • Selective targeting of virulence rather than growth may reduce selection pressure

  • Biofilm targeting:

    • If PFA4 is involved in biofilm formation, inhibitors could disrupt this clinically challenging growth form

    • Potential to sensitize biofilms to conventional antifungals

    • Strategies to prevent biofilm formation in medical devices

Translational research framework:

Development StageKey ConsiderationsSuccess Metrics
Target validationGenetic and chemical validation of PFA4 essentialityGrowth/virulence impact
Hit identificationHigh-throughput screening of diverse chemical librariesActivity, selectivity
Lead optimizationStructure-activity relationship studiesPotency, pharmacokinetics
Preclinical testingAnimal models of C. glabrata infectionEfficacy, toxicity profiles
Combination studiesSynergy with existing antifungalsReduction in effective dose

Research into PFA4 function and inhibition could lead to much-needed new therapeutic options for drug-resistant C. glabrata infections, addressing an important unmet medical need .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.