Recombinant Candida glabrata pH-response regulator protein palH/RIM21 (RIM21)

Shipped with Ice Packs
In Stock

Description

Functional Role in pH Response

RIM21 is part of the conserved Rim/Pal pathway, which regulates fungal adaptation to alkaline environments . Key mechanisms include:

  • pH Sensing: RIM21, alongside Rim9 and Dfg16, forms a membrane complex detecting extracellular pH changes .

  • Signal Transduction: Under alkaline conditions, RIM21 triggers endocytosis of the sensor complex, recruiting ESCRT machinery (e.g., Snf7, Vps23) and activating the protease Rim13 .

  • RIM101 Activation: Cleavage of the transcription factor RIM101 enables its nuclear translocation, regulating genes involved in cell wall remodeling, hyphal growth, and antifungal tolerance .

Interaction Network

STRING database analysis reveals RIM21’s functional partners in Candida species :

Interacting ProteinFunctionInteraction Score
Rim9 (palI/RIM9)pH sensor component0.981
Rim8 (palF/RIM8)Arrestin-like protein mediating endocytosis0.974
Rim13 (palB/RIM13)Calpain-like protease cleaving RIM1010.936
Rim20 (palA/RIM20)Scaffold protein recruiting ESCRT-III and Rim130.935
Snf7ESCRT-III subunit required for multivesicular body formation0.846

Research Findings in Antifungal Tolerance

A 2018 study demonstrated the Rim pathway’s role in Candida albicans tolerance to azoles and echinocandins :

  • Gene Regulation: RNA sequencing of rim101 mutants revealed 1,002 differentially expressed genes, including:

    • Downregulated: PHR1 (cell wall maintenance), SKN1 (oxidative stress response).

    • Upregulated: KRE6 (β-glucan synthesis), MNN1 (mannosylation).

  • Mechanistic Insight: RIM21-mediated activation of RIM101 suppresses sphingolipid biosynthesis (IPT1) and enhances cell wall integrity under alkaline stress .

Applications in Research

  • Drug Target Screening: RIM21’s role in antifungal resistance makes it a candidate for targeting novel therapies .

  • Protein-Protein Interaction Studies: Used to map signaling pathways involving ESCRT and Rim proteins .

  • Structural Biology: Recombinant RIM21 aids in crystallography and mutagenesis studies to dissect pH-sensing mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
RIM21; CAGL0M03663g; pH-response regulator protein palH/RIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
RIM21
Target Protein Sequence
MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYAKNVKWSSFCDYGVPL YLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILMVYSTIFVITVALTVLS FLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQEHYGVANGNVFGTLLNSN LVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIMSIVSFIISAIVSYTDRVG IRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVSHLQMWYLALLTIAIVLLSP AMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHILKKAAQVKSLLGQKIYEDEQ EGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSNVGSNLSSKESSSLPAQMNSTG ISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSKSIIQLRKRNSETVKNERSNEEL SIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESECESNNILNESIDSHFPENGAGSV
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Database Links
Protein Families
PalH/RIM21 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of RIM21 in Candida glabrata?

RIM21 is a transmembrane protein that functions as the primary pH sensor in the Rim pathway of Candida species. As demonstrated in studies on homologous proteins, RIM21 detects changes in environmental pH, particularly alkaline conditions, and initiates a signaling cascade that ultimately leads to the activation of the transcription factor Rim101p through proteolytic cleavage . This pH-sensing function is critical for the adaptation of C. glabrata to changing pH environments both within the host and in external settings. Unlike accessory proteins in the pathway, transient degradation of RIM21 completely abolishes pH sensing, confirming its central role as the actual sensor protein rather than just a component of the sensing machinery .

How does the Rim pathway function in C. glabrata?

The Rim pathway in C. glabrata functions through a complex sensing mechanism where external pH is detected by a protein complex at the plasma membrane. Based on homologous systems, this complex consists of the transmembrane proteins RIM21 and Dfg16, along with the arrestin-like protein Rim9 . Under neutral-alkaline conditions, this leads to hyperphosphorylation of Rim8 (an arrestin-like protein), which triggers endocytosis of the membrane complex and recruitment of endosomal sorting complexes required for transport (ESCRT) . This process ultimately results in the cleavage of the C-terminal inhibitory domain of Rim101 (the pathway's transcription factor) by the signaling protease Rim13, allowing Rim101 to migrate to the nucleus and regulate expression of target genes involved in adaptation to alkaline conditions .

How does RIM21 interact with other components of the Rim pathway?

RIM21 physically interacts with Dfg16 and Rim9 to form a sensor complex at the plasma membrane . This interaction is mutually dependent, meaning that the absence of any one of these proteins affects the stability and proper localization of the others. In particular, the cellular level of RIM21 is significantly decreased in dfg16Δ and rim9Δ mutants, suggesting that Dfg16 and Rim9 play auxiliary roles in maintaining adequate levels of RIM21 and facilitating its correct plasma membrane localization . Following pH-induced activation, this complex engages with downstream components including Rim8, Rim20, and Rim13, ultimately leading to the activation of the Rim101 transcription factor through proteolytic processing .

What experimental systems are commonly used to study RIM21 function?

Common experimental approaches to study RIM21 function include:

  • Genetic knockout models (rim21Δ mutants) to assess phenotypic consequences of RIM21 absence

  • Protein tagging (e.g., with HA epitope tags) to track protein localization and expression levels

  • Transient protein degradation systems to assess the immediate effects of RIM21 removal without genetic compensation effects

  • Fluorescence microscopy to visualize the subcellular localization and dynamics of RIM21 and its binding partners

  • Gene expression analyses to identify RIM21-dependent transcriptional responses to alkaline pH

  • Yeast two-hybrid or co-immunoprecipitation assays to identify protein-protein interactions within the Rim pathway

These methodologies have been instrumental in establishing RIM21 as the primary pH sensor and elucidating its relationships with other components of the pathway.

How does RIM21 specifically sense changes in environmental pH?

The molecular mechanism by which RIM21 senses pH changes appears to be linked to plasma membrane depolarization events. Research has demonstrated that even without external alkalization, the Rim101 pathway can be activated in a RIM21-dependent manner through either protonophore treatment or depletion of phosphatidylserine in the inner leaflet of the plasma membrane . Both of these conditions cause plasma membrane depolarization similar to what occurs during external alkalization. This suggests that RIM21 may not directly sense hydrogen ion concentration but rather detects consequent changes in plasma membrane electrical potential or organization .

The sensing mechanism likely involves conformational changes in RIM21 that occur in response to alterations in the plasma membrane's electrochemical properties. This is supported by observations that the Rim101 pathway also responds to altered lipid asymmetry in the plasma membrane, suggesting a complex interplay between membrane composition, electrical properties, and RIM21 activation . Future structural studies combined with membrane biophysics approaches will be necessary to fully elucidate the precise molecular events that occur during pH sensing by RIM21.

What are the methodological challenges in producing and studying recombinant C. glabrata RIM21?

Producing and studying recombinant C. glabrata RIM21 presents several significant challenges:

  • Membrane protein expression: As an integral membrane protein with multiple transmembrane domains, RIM21 is challenging to express in recombinant systems while maintaining proper folding and function.

  • Complex formation requirements: RIM21 functions as part of a multiprotein complex with Dfg16 and Rim9, and its stability depends on these interactions . This interdependence complicates expression systems, as the isolated protein may be unstable or incorrectly folded.

  • Post-translational modifications: The function of RIM21 likely depends on specific post-translational modifications that may be difficult to replicate in heterologous expression systems.

  • Functional assays: Developing assays to measure the pH-sensing activity of recombinant RIM21 in vitro is challenging, as it requires reconstitution of the membrane environment and downstream signaling components.

To address these challenges, researchers often employ approaches such as:

  • Expression in yeast systems with co-expression of interacting partners

  • Use of detergent screening to identify conditions that maintain protein stability

  • Nanodiscs or liposome reconstitution to provide a membrane-like environment

  • Development of fluorescence-based or FRET assays to detect conformational changes in response to pH

How does the function of C. glabrata RIM21 differ from its homologs in other fungal species?

While the Rim pathway is conserved across fungal species, significant functional differences exist between RIM21 in C. glabrata and its homologs:

SpeciesRIM21 HomologKey Functional Differences
Candida albicansRim21/Dfg16Functions in both pH sensing and morphological transitions; more directly linked to virulence factors including hyphal formation
Saccharomyces cerevisiaeRim21Well-characterized as primary pH sensor; less directly linked to antifungal resistance mechanisms
Aspergillus nidulansPalHLower sequence homology (27% with Rim21); requires PalI (Rim9 homolog) for plasma membrane localization
Candida glabrataRIM21Higher association with antifungal resistance; functions in organism genetically closer to S. cerevisiae than to C. albicans

These differences reflect the evolutionary divergence of these fungi and their adaptation to different environmental niches. C. glabrata's RIM21 function is particularly interesting given that this organism is more closely related genetically to Saccharomyces cerevisiae than to Candida albicans, yet causes Candida-type infections . This evolutionary context may explain some of the unique aspects of C. glabrata RIM21 function compared to its homologs.

What is the role of RIM21 in mediating antifungal resistance in C. glabrata?

The role of RIM21 in antifungal resistance in C. glabrata is complex and multifaceted. As the primary sensor in the Rim pathway, RIM21 initiates signaling that ultimately activates the transcription factor Rim101p, which has been implicated in mediating tolerance to both azole and echinocandin antifungals . The mechanism appears to involve several downstream pathways:

  • HSP90-mediated resistance: RNA sequencing analysis has revealed that Rim101 regulates the expression of HSP90, a major molecular chaperone known to be involved in antifungal tolerance . Rim pathway mutants show hypersensitivity to pharmacological inhibition of Hsp90, suggesting that RIM21 acts upstream of Hsp90 in conferring resistance .

  • Sphingolipid biosynthesis: The Rim pathway controls the expression of IPT1, a gene involved in sphingolipid biosynthesis, which affects membrane composition and potentially drug permeability or target accessibility .

  • Cell wall remodeling: The Rim pathway regulates numerous genes involved in cell wall biosynthesis and maintenance, including SKN1, PHR1, PHR2, and MNN1 . Alterations in cell wall structure can affect the penetration and efficacy of antifungal agents.

  • Stress adaptation responses: RIM21-initiated signaling contributes to general stress adaptation, which may indirectly enhance survival during antifungal exposure.

Understanding these mechanisms provides potential targets for combination therapies that could overcome antifungal resistance by inhibiting the Rim pathway alongside conventional antifungal treatments .

How does plasma membrane lipid composition affect RIM21 function?

Plasma membrane lipid composition significantly impacts RIM21 function through several mechanisms:

  • Lipid asymmetry sensing: Research has demonstrated that the Rim101 pathway, of which RIM21 is the primary sensor, can sense altered lipid asymmetry in the plasma membrane . Specifically, depletion of phosphatidylserine in the inner leaflet of the plasma membrane activates the pathway in a RIM21-dependent manner, suggesting that RIM21 can detect changes in lipid distribution across the membrane bilayer .

  • Membrane depolarization: Changes in lipid composition that affect membrane electrical properties appear to be sensed by RIM21. Both protonophore treatment and phosphatidylserine depletion cause plasma membrane depolarization and activate the Rim101 pathway through RIM21 .

  • Protein-lipid interactions: The localization of RIM21 to specific patches in the plasma membrane suggests possible interactions with particular lipid domains or microenvironments. These interactions may be critical for maintaining the protein in a conformation that can respond appropriately to pH changes.

  • Complex stability: The stability and proper localization of the RIM21-Dfg16-Rim9 complex may depend on specific lipid environments within the membrane.

These findings highlight the intricate relationship between membrane composition and RIM21 function, suggesting that lipid alterations may represent an additional layer of regulation for the Rim pathway beyond direct pH sensing.

What techniques are most effective for studying RIM21 localization and dynamics in living cells?

Several advanced techniques have proven effective for studying RIM21 localization and dynamics:

  • Fluorescent protein fusions: Tagging RIM21 with fluorescent proteins like GFP or mCherry allows real-time visualization of its distribution and movement in living cells. Care must be taken to ensure the tags don't interfere with protein function.

  • Super-resolution microscopy: Techniques such as STORM, PALM, or SIM provide resolution beyond the diffraction limit, allowing detailed visualization of RIM21's patchy distribution in the plasma membrane .

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can measure the mobility of RIM21 within the membrane and determine whether it changes in response to pH shifts.

  • Single-particle tracking: For studying the dynamics of individual RIM21 molecules or complexes in response to pH changes or other stimuli.

  • Correlative light and electron microscopy (CLEM): Combines fluorescence microscopy with electron microscopy to correlate RIM21 localization with ultrastructural features.

  • Proximity labeling approaches: Techniques like BioID or APEX can identify proteins in the vicinity of RIM21 under different conditions, providing insights into dynamic protein-protein interactions.

  • Förster resonance energy transfer (FRET): Can be used to detect conformational changes in RIM21 or interactions with other proteins in response to pH changes.

Data acquisition methodologies should be combined with appropriate image analysis algorithms to quantify parameters such as diffusion coefficients, cluster sizes, and co-localization indices for comprehensive characterization of RIM21 behavior.

What expression systems are optimal for producing recombinant C. glabrata RIM21?

The selection of an expression system for recombinant C. glabrata RIM21 should consider several factors specific to this membrane protein:

Expression SystemAdvantagesLimitationsOptimization Strategies
Saccharomyces cerevisiaeClosely related to C. glabrata; natural presence of Rim pathway components; proper post-translational modificationsLower protein yields compared to bacterial systemsUse strong inducible promoters (GAL1); optimize codon usage; include C-terminal purification tags
Pichia pastorisHigher protein yields than S. cerevisiae; ability to grow to high cell densities; proper protein foldingMay lack some specific interacting partnersUse AOX1 promoter; optimize culture conditions; co-express stabilizing partners (Dfg16, Rim9)
Escherichia coliRapid growth; high protein yields; simple genetic manipulationLacks machinery for eukaryotic post-translational modifications; often forms inclusion bodies with membrane proteinsUse specialized strains (C41/C43); express as fusion with solubility enhancers (MBP); add lipids during purification
Insect cellsEukaryotic processing; good for complex proteinsMore expensive; slower expressionOptimize Baculovirus vector design; use Flash-BAC system for rapid recombinant generation
Cell-free systemsAllows incorporation of unnatural amino acids or labels; avoids toxicity issuesExpensive; lower yields for membrane proteinsSupplement with lipids or nanodiscs; optimize reaction conditions

Based on the available research, yeast-based expression systems (particularly S. cerevisiae) appear most suitable for functional RIM21 production, as they provide the native-like membrane environment and auxiliary proteins needed for proper folding and stability . Regardless of the system chosen, co-expression with Dfg16 and Rim9 should be considered, given their role in maintaining RIM21 stability and proper localization .

How can the pH-sensing function of RIM21 be assayed in vitro?

Assaying the pH-sensing function of RIM21 in vitro presents significant challenges due to the protein's membrane localization and dependence on a multiprotein complex. Several methodological approaches can be employed:

  • Reconstituted liposome systems:

    • Purified recombinant RIM21 (potentially with Dfg16 and Rim9) can be reconstituted into liposomes with defined lipid composition

    • pH changes can be induced by adjusting external buffer conditions

    • Fluorescent reporters inside liposomes can detect membrane potential changes

    • Alternatively, EPR or FRET-based sensors can detect conformational changes in RIM21

  • Microscale thermophoresis (MST):

    • This technique can detect binding of pH-dependent ligands or conformational changes in purified RIM21 in detergent micelles or nanodiscs

    • The assay can be performed across a pH gradient to determine response thresholds

  • Surface plasmon resonance (SPR):

    • Can be used to measure pH-dependent interactions between RIM21 and downstream components like Rim8

    • Requires immobilization of one component on a sensor chip and flowing the other component at different pH values

  • Electrical measurements in planar lipid bilayers:

    • If RIM21 forms or regulates ion channels, its activity can be measured using electrophysiological techniques

    • Changes in membrane conductance or capacitance in response to pH shifts can be recorded

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Can detect pH-dependent conformational changes in RIM21 structure

    • Identifies protein regions with altered solvent accessibility at different pH values

When designing these assays, it's critical to consider the role of membrane potential in RIM21 activation, as research suggests it responds to membrane depolarization events rather than directly to hydrogen ion concentration .

What strategies can overcome difficulties in crystallizing membrane proteins like RIM21?

Crystallizing membrane proteins like RIM21 presents significant challenges due to their hydrophobic nature and conformational flexibility. Several advanced strategies can improve success rates:

  • Protein engineering approaches:

    • Truncation of flexible termini or loops while preserving core sensing domains

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL, rubredoxin)

    • Surface entropy reduction through mutation of high-entropy residues (Lys/Glu clusters)

    • Thermostabilizing mutations identified through alanine scanning or directed evolution

  • Crystallization techniques:

    • Lipidic cubic phase (LCP) crystallization, which provides a native-like membrane environment

    • Bicelle crystallization, which combines aspects of detergent and lipid environments

    • Counter-diffusion methods in capillaries for slower, more ordered crystal growth

    • Microseeding to promote nucleation and crystal formation

  • Detergent and lipid optimization:

    • Systematic screening of detergents, focusing on maltoside and glucoside-based options

    • Addition of specific lipids known to stabilize membrane proteins (e.g., cholesterol, cardiolipin)

    • Use of novel amphipols or nanodiscs to maintain native-like environment

  • Co-crystallization strategies:

    • Inclusion of stabilizing binding partners (Dfg16, Rim9)

    • Co-crystallization with antibody fragments (Fab) or nanobodies

    • Addition of small molecule stabilizers identified through thermal stability assays

  • Alternative structural methods:

    • Cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structure determination

    • Solid-state NMR for structural information without crystallization

    • X-ray free electron laser (XFEL) diffraction from microcrystals

Given the challenges, a hybrid approach combining crystallographic data with computational modeling and validation through biochemical and biophysical methods may be most effective for understanding RIM21 structure-function relationships.

How can genetic manipulation techniques be optimized for studying RIM21 in C. glabrata?

Optimizing genetic manipulation techniques for C. glabrata RIM21 studies requires addressing the unique challenges of this pathogenic yeast:

  • CRISPR-Cas9 optimization:

    • Design of C. glabrata-specific promoters for Cas9 expression

    • Optimization of sgRNA design algorithms for C. glabrata genome

    • Development of ribonucleoprotein (RNP) delivery methods to bypass transformation inefficiency

    • Implementation of transient CRISPR systems to avoid potential off-target effects

  • Homologous recombination enhancements:

    • Use of long homology arms (>500 bp) to improve integration efficiency

    • Optimization of selectable marker systems specific for C. glabrata

    • Development of recyclable marker systems using site-specific recombinases

    • Implementation of split-marker approaches to reduce false positive rates

  • Conditional expression systems:

    • Development of tightly regulated inducible promoters for C. glabrata

    • Optimization of tetracycline-responsive or estradiol-inducible systems

    • Creation of destabilization domain-based protein control systems

    • Implementation of auxin-inducible degron technology for rapid protein depletion

  • Reporter system development:

    • Optimization of fluorescent protein variants for C. glabrata expression

    • Creation of transcriptional reporters for RIM21-dependent genes

    • Development of split-protein complementation assays for protein-protein interactions

    • Implementation of luminescence-based reporters for high-sensitivity detection

  • Transformation protocol optimization:

    • Electroporation parameters adjustment for C. glabrata

    • Cell wall weakening treatments to improve DNA uptake

    • Development of specialized media for recovery after transformation

    • Optimization of selection conditions to reduce background

These approaches should be combined with careful phenotypic validation to ensure that genetic modifications produce the expected effects on RIM21 function and Rim pathway activity.

How can targeting RIM21 contribute to novel antifungal strategies?

Targeting RIM21 presents a promising approach for novel antifungal development for several reasons:

  • Pathway-specific vulnerability: The Rim pathway mediates antifungal tolerance in Candida species, particularly for azoles and echinocandins . Inhibiting RIM21 could potentially re-sensitize resistant strains to existing antifungals, providing a strategy for combination therapy.

  • Fungal specificity: The Rim pathway is fungus-specific and conserved among members of the fungal kingdom . This makes RIM21 an attractive target for developing antifungals with minimal host toxicity, as humans lack this pathway.

  • Indirect targeting of critical processes: Research has shown that Rim101 acts upstream of Hsp90, a major molecular chaperone involved in stress response and antifungal resistance . Targeting the Rim pathway through RIM21 inhibition could indirectly but specifically target Hsp90 in yeasts, disrupting multiple resistance mechanisms simultaneously.

  • Potential approaches for RIM21 targeting:

    • Small molecule inhibitors that disrupt RIM21's pH-sensing ability

    • Compounds that interfere with RIM21-Dfg16-Rim9 complex formation

    • Molecules that promote RIM21 degradation or internalization

    • Peptide-based inhibitors that mimic interaction interfaces

  • Combined targeting strategy: Inhibiting RIM21 alongside traditional antifungals could create synergistic effects, potentially allowing lower doses of existing drugs while maintaining efficacy and reducing resistance development.

This strategy is particularly relevant for C. glabrata infections, which have shown increasing prevalence and antifungal resistance since the 1990s . As C. glabrata demonstrates high resistance to some antifungal medications, particularly fluconazole , novel approaches targeting RIM21 could address an important clinical need.

What are the potential impacts of pH environment variation on C. glabrata RIM21 function during host infection?

The pH environment varies significantly across different host niches where C. glabrata may establish infection, potentially impacting RIM21 function in complex ways:

Host LocationTypical pH RangePotential Impact on RIM21 Function
Oral cavity6.2-7.6Variable activation depending on oral region and diet; may contribute to oral thrush persistence
Bloodstream7.35-7.45Likely activation of RIM21 and Rim pathway due to alkaline pH; may enhance survival during candidemia
Vaginal tract3.8-4.5Likely inactive in healthy individuals; changes during infection or hormonal fluctuations may trigger activation
Gastrointestinal tract1.5-8.0 (varies by region)Differential activation as fungi transit through GI tract; may influence colonization patterns
Urinary tract4.5-8.0Variable activation; may contribute to antifungal tolerance during UTIs
Phagolysosomes4.5-5.0Likely inactive within macrophages; activation may occur upon escape

These pH variations create a complex landscape for RIM21 function during infection:

  • Adaptive gene expression: RIM21 activation leads to transcriptional changes via Rim101, potentially optimizing gene expression for each host niche encountered.

  • Morphological adaptation: Although C. glabrata cannot form true hyphae unlike C. albicans, RIM21-mediated responses may still affect cell morphology and biofilm formation in response to host pH .

  • Stress response coordination: RIM21 activation coordinates responses to not only pH but also other stresses encountered in the host, including oxidative stress and nutrient limitation.

  • Antifungal susceptibility modulation: pH-dependent activation of RIM21 may contribute to variable antifungal efficacy across different infection sites, potentially explaining some treatment failures .

Understanding how RIM21 responds to these different environments could inform targeted therapeutic approaches for specific types of C. glabrata infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.