Recombinant Candida glabrata pH-response regulator protein palI/RIM9 (RIM9)

Shipped with Ice Packs
In Stock
Cat. No.
BT2139109
Source
in vitro E.coli expression system
Synonyms
RIM9; CAGL0F06545g; pH-response regulator protein palI/RIM9
Quick Inquiry

Description

Functional Role in the Rim Pathway

RIM9 operates within the Rim pathway, a conserved pH-sensing cascade critical for fungal adaptation to alkaline environments. Key steps include:

  1. pH Sensing:

    • RIM9 forms a membrane complex with RIM21 (homolog of S. cerevisiae Rim21) to detect alkaline pH .

    • At neutral/alkaline pH, this complex undergoes endocytosis, recruiting ESCRT (endosomal sorting complexes) machinery .

  2. Signal Transduction:

    • RIM20 and RIM13 are recruited to the endosome, activating the protease RIM13.

    • RIM13 cleaves the inhibitory C-terminal domain of RIM101, the transcription factor that regulates pH-responsive genes .

  3. Downstream Targets:

    • RIM101 controls genes involved in iron metabolism, cell wall integrity, and stress tolerance (e.g., HSP90, IPT1) .

    • In C. albicans, Rim101 activation enhances resistance to antifungals like azoles and echinocandins .

Role in Antifungal Tolerance

Disruption of RIM9 or other Rim proteins in C. albicans increases sensitivity to antifungals, suggesting conserved mechanisms in C. glabrata . Key findings include:

  • HSP90 and IPT1 (sphingolipid biosynthesis) are downstream targets of RIM101, linking pH adaptation to antifungal tolerance .

  • Pharmacological inhibition of HSP90 synergizes with Rim pathway disruption, highlighting potential therapeutic strategies .

Inter-Species Interactions

C. glabrata exploits C. albicans hyphae for host colonization, mediated by pH-regulated adhesins (e.g., EPA8, AWP2) . While RIM9 itself is not directly implicated in this interaction, its role in regulating pH-responsive genes may indirectly influence biofilm formation and adhesion .

Comparative Insights Across Fungi

OrganismRIM9 LengthKey FunctionSource
C. glabrata246 aapH sensing, Rim pathway activation
Yarrowia lipolytica728 aapH response, but structural divergence noted
C. albicans346 aapH signaling, antifungal tolerance regulation

While RIM9 is conserved, structural differences (e.g., length) suggest species-specific adaptations .

Future Directions

  1. Therapeutic Targeting: Inhibiting RIM9 or downstream targets (e.g., HSP90) may enhance antifungal efficacy .

  2. Diagnostic Biomarkers: Recombinant RIM9 could aid in detecting C. glabrata infections or monitoring treatment responses .

  3. Pathogenesis Studies: Investigating RIM9 in C. glabrata’s ability to colonize mucosal surfaces or evade host immunity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RIM9; CAGL0F06545g; pH-response regulator protein palI/RIM9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
RIM9
Target Protein Sequence
MHLFDLRTLLAILVSICVVFQAFPLATVPLNKNLILGQYMGYHFGVFGWCFVDKGVTIAC HCKFRPDSIETYKYTDQLLFPSLYKVTISTLLVVHPVSFAFTCILWIMALIIRLSRFGRC PIFILSAATWSLAAFLLALLSALVDLLLFVNKLKWPGWLVLASVPLMAICCSWLWSLRRQ VSAIFYERKAYATQTYSRFDSMELSHIDTKFSDDQSIYETYTLERVPYSKNEAIEEPALT YYTSSS
Uniprot No.
Q6FU42

Target Background

Function

Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline pH.

Database Links

KEGG: cgr:CAGL0F06545g

STRING: 284593.XP_446252.1

Protein Families
PalI/RIM9 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.