Recombinant Candida glabrata Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YOP1

YOP1 (UniProt identifier: Q6FMU3) is a glycosylphosphatidylinositol (GPI)-linked protein in C. glabrata, implicated in pathogenicity and immune evasion. The recombinant form includes an N-terminal His tag to facilitate purification via nickel affinity chromatography. Key features include:

ParameterDetail
Source OrganismCandida glabrata (strain not specified)
Length177 amino acids (full-length)
TagN-terminal His tag
Expression HostEscherichia coli
AccessionQ6FMU3

Source: Product specifications from Creative Biomart .

Protein Structure

YOP1 lacks detailed structural data in publicly available databases, but its homologs in other Candida species provide clues:

  • FMP48 (S. cerevisiae): A mitochondrial protein induced by UV radiation .

  • HSL1 (C. albicans): Regulates morphology and virulence .

  • YOP1 in C. glabrata: No mitochondrial targeting sequence detected , suggesting cytoplasmic or cell-surface localization.

Functional Roles

While the recombinant protein’s direct functions are unstudied, native YOP1 is linked to:

  • Virulence: A yop1Δ mutant showed reduced pathogenicity in Drosophila melanogaster, suggesting roles in immune evasion .

  • Stress Response: Homologs in C. albicans (e.g., HSL1) modulate cell cycle progression and kidney colonization .

Research Applications

The recombinant YOP1 protein serves as a tool for:

  1. Protein-Protein Interaction Studies: Investigating binding partners in host-pathogen interactions.

  2. Antigenic Epitope Mapping: Identifying immune targets for vaccine development.

  3. Structural Biology: Crystallization studies to resolve its 3D structure.

  4. Functional Assays: Assessing enzymatic or regulatory roles in vitro.

Table 2: Comparative Analysis of YOP1 Homologs

OrganismGeneFunctionLocalization
C. glabrataYOP1Virulence, immune evasion Cytoplasm/Membrane
S. cerevisiaeFMP48Mitochondrial protein, UV response Mitochondria
C. albicansHSL1Morphology regulation, kidney colonization Cytoplasm/Membrane

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YOP1; CAGL0K05203g; Protein YOP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
YOP1
Target Protein Sequence
MADVISSLQTQLKELDTKFAGNNVLNQLEQRTNLPKSYLVVGSTIFYLLLIFINVGGIGE ILGNFAGFVIPAYYSILALKTTTTKDDTQLLTYWIVFSFLNVIEFWSKALLYIIPFYWFL KTIFLLYIALPQTGGATMIYNRFISPLTDKYILGPKKTDGVQQSVKEASRATGAATH
Uniprot No.

Target Background

Function

Involved in membrane/vesicle trafficking.

Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of secreted proteins in Candida glabrata pathogenesis?

Secreted proteins from Candida glabrata play critical roles in host colonization and inter-species interactions. Recent research has identified that C. glabrata secretes unique small proteins that mediate communication with other Candida species, particularly C. albicans. One such protein, Yhi1 (Yeast to Hypha Inducer 1), induces hyphal growth in C. albicans, which is essential for host tissue invasion . This inter-species molecular communication is particularly significant in mixed-species invasive candidiasis, where the presence of C. albicans appears nearly essential for successful host colonization by C. glabrata . Understanding these secreted proteins provides insight into fungal pathogenesis mechanisms and potential targets for therapeutic intervention.

How are functional motifs identified in Candida glabrata proteins?

Identifying functional motifs in C. glabrata proteins requires a multi-faceted approach combining in silico analysis and experimental validation. Initial analysis typically utilizes tools like InterProScan and MOTIF Search to identify known domains, though novel motifs may not be detected through these methods alone . When conventional approaches yield limited results, researchers can employ structure-function analyses through expression of protein fragments.

For example, with the Yhi1 protein, researchers discovered a novel functional pentapeptide motif (AXVXH) by:

  • Expressing N-terminal (Yhi1 1-32) and C-terminal (Yhi1 33-66) halves separately

  • Testing the biological activity of each fragment

  • Creating synthetic peptide derivatives with modified sequences

  • Confirming function by incorporating the pentapeptide sequence into unrelated proteins (e.g., adding ADVWH to GFP)

This methodical approach reveals functional elements that might otherwise remain undetected.

What experimental approaches are most effective for studying protein-mediated inter-species communication?

The most effective experimental approaches for studying protein-mediated inter-species communication in Candida combine:

  • Conditioned media experiments: Collecting cell-free supernatant (CFS) from one species and testing its effects on another species. This approach was successfully used to demonstrate that secretions from C. glabrata induce hyphal growth in C. albicans .

  • Genetic manipulation: Creating deletion mutants of candidate genes and testing for loss of inter-species communication phenotypes. For Yhi1, deletion of the encoding gene resulted in loss of hyphal induction capability .

  • Protein purification and characterization: Isolating specific proteins from the secretome and testing their activity independently.

  • Heterologous expression systems: Expressing candidate proteins in model organisms to confirm their activity and study their regulation.

  • Microscopy and phenotypic assays: Visualizing and quantifying morphological changes induced by inter-species communication, such as the yeast-to-hypha transition in C. albicans .

How is the mating MAPK signaling pathway repurposed in Candida glabrata's inter-species interactions?

Despite C. glabrata's predominantly asexual reproduction, recent research reveals that its mating MAPK signaling pathway has been evolutionarily repurposed for inter-species communication. The regulation of Yhi1, a protein essential for interaction with C. albicans, occurs through components of this pathway .

Key findings include:

  • Yhi1 expression is post-transcriptionally regulated by the mating MAPK (CgFus3) signaling pathway

  • Yhi1 efflux requires the pheromone transporter CgSte6, which shares approximately 40% sequence homology with the pheromone transporter in S. cerevisiae

  • While transcription of YHI1 is not affected in mutants of MAPKs and CgSte6, protein expression and secretion are significantly impacted

This represents a fascinating example of evolutionary repurposing, where C. glabrata maintains components of the mating pathway despite being predominantly asexual, and utilizes this machinery for inter-species communication rather than mating. The CgGpr1 and CgGpa1 proteins mediate activation of CgKss1 MAPK, which appears involved in regulating CgSte6 expression required for Yhi1 efflux .

What molecular mechanisms regulate the secretion of small proteins in Candida glabrata?

The secretion of small proteins in Candida glabrata involves sophisticated molecular machinery, particularly evident in the secretion of the Yhi1 protein:

  • Transporter-mediated efflux: Yhi1 utilizes the CgSte6 transporter, homologous to the pheromone transporter in S. cerevisiae, for its secretion . This represents a specialized export pathway distinct from conventional secretion.

  • MAPK pathway regulation: Two MAPK pathways influence secretion:

    • The CgFus3 MAPK pathway regulates Yhi1 expression post-transcriptionally

    • The CgKss1 MAPK pathway appears involved in regulating the CgSte6 transporter

  • G-protein coupled receptor signaling: CgGpr1 (receptor) and CgGpa1 (G-protein) are required for efficient Yhi1 secretion, suggesting that external signals may modulate the secretion process .

Experimental evidence demonstrates that mutations in any of these components (CgGpr1, CgGpa1, CgKss1, CgFus3, or CgSte6) prevent the detection of Yhi1 in the extracellular milieu, confirming their essential roles in the secretion process .

What structural elements determine the specificity of Candida inter-species protein interactions?

The specificity of inter-species protein interactions among Candida species appears to be determined by precise structural elements within signaling proteins. Research on the Yhi1 protein reveals:

  • Novel functional motifs: The pentapeptide motif AXVXH (where X represents variable amino acids) is essential for Yhi1's function in inducing hyphal growth in C. albicans . This motif appears unique to this interaction.

  • Binding specificity: The Yhi1-based inter-species interaction is specific to C. glabrata and C. albicans, not functioning with other common Candida species .

  • Localization requirements: When fused with GFP, the ADVWH pentapeptide enables localization to the surface of both yeast and hyphal cells, whereas GFP without this motif shows limited cellular localization .

These findings suggest that specific short amino acid sequences can determine the specificity of inter-species communication, enabling targeted molecular recognition between particular Candida species.

What protocols are recommended for studying post-transcriptional regulation of protein expression in Candida species?

Investigating post-transcriptional regulation in Candida species requires a comprehensive approach combining multiple techniques:

  • Comparative transcript and protein analysis:

    • RT-qPCR to quantify mRNA levels

    • Western blotting with specific antibodies to detect protein expression

    • Compare results to identify discrepancies between transcript and protein levels

  • Protein stability assessment:

    • Cycloheximide chase assays to measure protein half-life

    • Proteasome inhibitors to evaluate degradation pathways

  • Mutant analysis pipeline:

    • Generate pathway-specific mutants (e.g., MAPK components)

    • Analyze transcript levels in mutants using RT-qPCR

    • Analyze protein levels in cell lysates and extracellular media

    • Complement mutants to confirm specificity of effects

For example, analysis of Yhi1 regulation revealed that while YHI1 transcript levels remained unchanged in various signaling pathway mutants, the protein was undetectable in CgFus3 MAPK mutants, indicating post-transcriptional regulation .

MutantYHI1 mRNA LevelIntracellular Yhi1 ProteinExtracellular Yhi1 Protein
Wild-typeNormalDetectedDetected
CgGpr1ΔNormalDetectedNot detected
CgGpa1ΔNormalDetectedNot detected
CgKss1ΔNormalDetectedNot detected
CgFus3ΔNormalNot detectedNot detected
CgSte6ΔNormalDetectedNot detected

How can researchers effectively design experiments to test biological activity of fungal secreted proteins?

Designing robust experiments to test the biological activity of fungal secreted proteins requires a systematic approach:

  • Protein production and isolation:

    • Express recombinant proteins with appropriate tags for purification

    • For proteins like Yhi1, consider expressing protein fragments to identify functional domains

    • Collect cell-free supernatant (CFS) as a source of naturally secreted proteins

  • Activity assays:

    • Design phenotypic readouts relevant to the protein's suspected function

    • For inter-species communication proteins, monitor morphological changes (e.g., hyphal induction)

    • Include appropriate positive and negative controls

  • Structure-function analysis:

    • Generate synthetic peptide derivatives to test specific motifs

    • Create chimeric proteins by fusing candidate motifs with reporter proteins (e.g., GFP)

    • Test functionality using the established activity assays

  • Localization studies:

    • Use fluorescent microscopy to determine where proteins localize

    • Compare localization patterns between wild-type proteins and mutant/truncated variants

  • Dose-response testing:

    • Test multiple concentrations to establish dose-dependent effects

    • Create standardized curves for quantitative analysis

This approach helped researchers identify that the AXVXH pentapeptide motif is sufficient for Yhi1's function, even when transferred to an unrelated protein .

What techniques yield reliable results for investigating novel functional motifs in fungal proteins?

Investigating novel functional motifs in fungal proteins requires a combination of computational and experimental approaches:

  • Initial in silico screening:

    • Apply multiple prediction tools (InterProScan, MOTIF Search)

    • Perform comparative sequence analysis across strains and species

    • Identify conserved regions as potential functional motifs

  • Systematic fragment analysis:

    • Express protein fragments of various lengths

    • Test each fragment for retention of biological activity

    • Narrow down to minimal functional units

  • Site-directed mutagenesis:

    • Perform alanine scanning of candidate motifs

    • Create point mutations at conserved residues

    • Test mutants for altered function

  • Functional transfer experiments:

    • Incorporate candidate motifs into unrelated proteins

    • Test if the motif confers new functionality

    • For example, incorporating the ADVWH pentapeptide into GFP enabled it to induce hyphal growth in C. albicans

  • Structural characterization:

    • Determine three-dimensional structure when possible

    • Correlate structural features with functional data

This comprehensive approach enabled the identification of the AXVXH motif in Yhi1, a finding that would have been missed using conventional domain prediction tools alone .

How can identification of inter-species communication proteins inform antifungal drug development?

The discovery of proteins mediating inter-species communication offers compelling new targets for antifungal drug development:

  • Targeting virulence mechanisms: Proteins like Yhi1 that promote pathogenic traits (e.g., hyphal growth induction) represent targets that could reduce virulence without directly killing the fungi, potentially reducing selective pressure for resistance .

  • Disrupting cooperative pathogenesis: In mixed-species infections, targeting the molecular communication between species could prevent the synergistic pathogenicity observed in conditions like invasive candidiasis .

  • Novel peptide-based therapeutics: Structure-function analyses of communication proteins can inform the development of synthetic peptides with antifungal properties. For example, researchers serendipitously discovered that a synthetic peptide derivative (Yhi12-13) demonstrated dose-dependent antifungal activity against both C. albicans and C. glabrata .

  • Biomarker development: Proteins like Yhi1 could serve as biomarkers for detecting mixed-species infections, enabling more targeted treatment approaches .

The specific discovery that certain Yhi1-derived peptides can block hyphal growth in C. albicans even in the presence of strong inducers (5% serum) while also affecting C. glabrata growth highlights the potential of these communication proteins as templates for developing novel antifungal agents .

What are the challenges in developing experimental systems to study mixed-species Candida infections?

Developing experimental systems to study mixed-species Candida infections presents several significant challenges:

  • Differential growth rates: C. albicans and C. glabrata have different growth kinetics, making it difficult to maintain consistent population ratios in experimental settings.

  • Species-specific media requirements: Optimizing culture conditions that support both species equally can be challenging.

  • Distinguishing species in mixed cultures: Requires development of species-specific markers or reporters for accurate tracking and quantification.

  • Controlling environmental variables: Factors like pH, temperature, and nutrient availability can differentially affect each species and their interactions.

  • In vivo model development: Animal models must recapitulate the complex host environments where mixed infections occur while allowing for measurement of species-specific contributions to pathogenesis.

  • Separating direct and indirect effects: Determining whether observed phenotypes result from direct inter-species communication versus competition for resources or host-mediated effects requires careful experimental design.

  • Temporal dynamics: Inter-species communication may vary at different stages of infection, necessitating time-course experiments.

Addressing these challenges requires integrated approaches combining molecular biology techniques, advanced imaging, and sophisticated in vivo models to fully understand the complex dynamics of mixed-species Candida infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.