Recombinant Candida glabrata Rhomboid protein 2 (RBD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
In general, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
RBD2; CAGL0H00803g; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
RBD2
Target Protein Sequence
MIAPQRMLMPEGRPPAGLTTGLLIFLTFLFGISQLYEDFKNHFVLTPNSLFDIDLGKLSL YPLMHLSYLHLVFNALAIVGPLNNFESSHGTIHTGVVLNLSAVIAGIIYCVVSRLLSLET GVAGASGWVFTFITYLCVKESQLYPRLELSRFIPGVTQSIPTQFTPVVFLLFTAIVFFQS SFLGHTAGMIVGYIMGYGETWFNILIPPAWIIEKIEEKADPLINLIPFGIKFYRSTEINT DDGYRSFFPGQEVLPTTTPGNVLGTA
Uniprot No.

Target Background

Function
This protein is a probable serine protease.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid Protein 2 (RBD2) and what is its significance in Candida species?

Rhomboid proteins are intramembrane serine proteases that play crucial roles in various cellular processes across different organisms. In Candida species, Rhomboid Protein 2 (RBD2) is believed to participate in proteolytic processing of membrane proteins that may contribute to pathogenesis. While comprehensive research exists on Candida albicans RBD2, which consists of 284 amino acids with a highly hydrophobic transmembrane structure, research on Candida glabrata RBD2 is still developing . The significance of RBD2 is increasingly appreciated in the context of inter-species fungal interactions, particularly in mixed Candida infections where C. albicans and C. glabrata form a pathogenic partnership .

How do rhomboid proteins in C. glabrata differ from those in C. albicans?

While both species possess rhomboid proteins, their functional roles may differ based on the distinct pathogenic mechanisms of each species. C. albicans is polymorphic and can form hyphae, whereas C. glabrata lacks this morphological flexibility but demonstrates higher antifungal resistance . This fundamental difference suggests that rhomboid proteins might serve species-specific functions. C. albicans RBD2 has been characterized as a full-length 284 amino acid protein with multiple transmembrane domains , while C. glabrata rhomboid proteins remain less characterized but likely participate in cell wall remodeling and potentially in the secretion of factors that influence inter-species communication .

What expression systems are recommended for recombinant RBD2 production?

The most efficient expression system for recombinant RBD2 production is E. coli, particularly for structural and biochemical studies. Based on established protocols for C. albicans RBD2, the protein can be expressed with an N-terminal His-tag to facilitate purification . The expression construct should contain the full-length sequence (amino acids 1-284 for C. albicans RBD2), and special consideration must be given to the highly hydrophobic nature of transmembrane domains. For functional studies, yeast expression systems like Saccharomyces cerevisiae or Pichia pastoris may provide more appropriate post-translational modifications, though protein yields are typically lower than bacterial systems.

What purification strategy works best for recombinant RBD2?

A recommended purification protocol for recombinant His-tagged RBD2 includes:

  • Cell lysis under denaturing conditions (8M urea) due to the hydrophobic nature of the protein

  • Initial purification using Ni-NTA affinity chromatography

  • Refolding through gradual dialysis against decreasing concentrations of urea

  • Secondary purification step using size-exclusion chromatography

  • Quality assessment by SDS-PAGE to ensure >90% purity

Storage should avoid repeated freeze-thaw cycles, with recommended aliquoting in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For long-term storage, addition of 50% glycerol and storage at -80°C is advised.

How can researchers validate the structural integrity of purified recombinant RBD2?

Validation of structural integrity should employ multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to determine protein stability

  • Activity assays using fluorogenic peptide substrates to confirm proteolytic function

  • Western blot analysis with specific antibodies, considering that recombinant proteins may migrate differently than predicted (as observed with related Candida proteins)

How can recombinant RBD2 be used to study Candida species interactions?

Recombinant RBD2 offers powerful approaches to investigate inter-species Candida interactions:

  • Co-culture experiments: Using purified RBD2 in co-culture systems of C. albicans and C. glabrata to assess its effect on hyphal induction or suppression. Recent research has revealed that C. glabrata produces proteins that induce hyphal growth in C. albicans through specific pentapeptide motifs (AXVXH) . RBD2 may play a role in processing such signaling molecules.

  • Protein-protein interaction studies: Employing pull-down assays with recombinant RBD2 to identify binding partners in both C. albicans and C. glabrata, particularly focusing on cell wall proteins and secreted factors.

  • Functional domain mapping: Creating truncated versions of RBD2 to identify which domains are essential for specific functions, similar to approaches used for other Candida proteins like Yhi1 .

What is the role of RBD2 in Candida pathogenesis and host-pathogen interactions?

RBD2 may contribute to Candida pathogenesis through multiple mechanisms:

  • Cell wall remodeling: Rhomboid proteases potentially process proteins involved in cell wall biogenesis, affecting immune recognition. Different C. glabrata strains (CBS138 and BG2) show variations in cell wall carbohydrate exposure that influence immune interactions .

  • Immune evasion: RBD2 might process surface proteins that interact with host immune cells, potentially modifying macrophage recognition patterns. Experimental approaches should include:

    • Macrophage phagocytosis assays with wild-type and RBD2-deficient strains

    • Cytokine profiling following immune cell exposure to recombinant RBD2

    • In vivo infection models (e.g., Galleria mellonella) to assess virulence

  • Nutrient acquisition: Drawing parallels from other Candida proteins, RBD2 may influence nutrient sensing and utilization pathways. C. glabrata strains demonstrate different capacities to utilize nitrogen sources like tryptophan and methionine , and proteases like RBD2 might process nutrient sensors or transporters.

How do mutations in RBD2 affect protein function and what methodologies can detect these effects?

To investigate the impact of RBD2 mutations:

  • Site-directed mutagenesis: Target conserved catalytic residues (serine and histidine) and assess changes in proteolytic activity.

  • Domain swapping: Exchange domains between C. albicans and C. glabrata RBD2 to identify species-specific functional regions.

  • Functional assays:

    • Proteolytic activity using fluorogenic substrates

    • Cell wall integrity assays with cell wall-perturbing agents

    • Growth rate determination under different stress conditions

    • Biofilm formation capacity assessment

  • Structural analysis: Use molecular dynamics simulations to predict how mutations affect protein folding and substrate binding, similar to approaches used to study interactions between other Candida proteins .

How does RBD2 interact with fungal signaling pathways?

Recent research on C. glabrata has revealed that proteins involved in inter-species communication can be regulated by the mating MAPK signaling pathway . Experimental approaches to investigate RBD2's relationship with signaling pathways include:

  • Transcriptional analysis: Measuring RBD2 expression under different signaling pathway activations, particularly focusing on MAPK pathways known to regulate other virulence factors.

  • Signaling pathway mutants: Examining RBD2 processing and function in strains with deletions in key components of signaling pathways.

  • Phosphoproteomic analysis: Determining if RBD2 undergoes phosphorylation as part of signaling cascades.

  • Co-immunoprecipitation: Identifying physical interactions between RBD2 and signaling pathway components.

What technologies can be employed to visualize RBD2 localization within Candida cells?

To study the subcellular localization and dynamics of RBD2:

  • Fluorescent protein fusions: Creating RBD2-GFP fusions with careful consideration of tag positioning to avoid disrupting transmembrane domains.

  • Immunofluorescence microscopy: Using antibodies against either native RBD2 or epitope tags incorporated into the protein.

  • Super-resolution microscopy: Employing techniques like STORM or PALM to achieve nanoscale resolution of RBD2 localization within membrane microdomains.

  • Live-cell imaging: Monitoring dynamic changes in RBD2 localization during cell growth, division, and in response to environmental stressors.

  • Electron microscopy: Using immunogold labeling to visualize RBD2 with nanometer precision in relation to cellular ultrastructure.

How can recombinant RBD2 be utilized for the development of novel antifungal strategies?

Drawing inspiration from research on other Candida proteins like Yhi1, recombinant RBD2 could be explored for antifungal development through:

  • Epitope mapping: Identifying immunogenic regions that could serve as vaccine candidates.

  • Inhibitor screening: Developing high-throughput assays using recombinant RBD2 to screen for small molecule inhibitors.

  • Peptide derivatives: Similar to how synthetic peptide derivatives of Yhi1 demonstrated antifungal activity , exploring if RBD2-derived peptides could exhibit antifungal properties.

  • Structure-based drug design: Using the crystal structure of RBD2 (once determined) to design specific inhibitors of its proteolytic activity.

What role might RBD2 play in diagnostic applications for Candida infections?

RBD2 could contribute to improved diagnostics for Candida infections:

  • Biomarker development: Evaluating whether RBD2 or its processed substrates are detectable in patient samples during infection.

  • Species-specific detection: Exploiting sequence differences between C. albicans and C. glabrata RBD2 to develop species-specific diagnostic assays, particularly valuable for mixed Candida infections.

  • Antibody-based detection systems: Developing antibodies against RBD2 epitopes for immunoassays.

  • Gene-based diagnostics: Using RBD2 gene sequences as targets for PCR-based detection methods, similar to how YHI1 has been proposed as a precise biomarker for C. glabrata .

What are the major challenges in working with recombinant RBD2 and how can they be addressed?

The key challenges in working with RBD2 include:

ChallengeRecommended Solution
Low solubility due to hydrophobic regionsUse specialized detergents (DDM, CHAPS); consider fusion tags like MBP; employ membrane mimetics
Proper refolding after purificationImplement gradual dialysis; screen different buffer conditions; use chaperone co-expression systems
Verifying correct foldingEmploy activity assays; use conformational antibodies; perform limited proteolysis
Maintaining stability during storageAdd stabilizers like trehalose (6%); store at -80°C in single-use aliquots; avoid freeze-thaw cycles
Accurate concentration determinationUse multiple methods (BCA, Bradford, absorbance at 280nm) and compare results

How can researchers distinguish between specific and non-specific effects when using recombinant RBD2 in functional assays?

To ensure experimental rigor when working with recombinant RBD2:

  • Proper controls: Include heat-denatured RBD2, catalytically inactive RBD2 mutants, and unrelated proteins of similar size/structure.

  • Dose-response relationships: Establish clear dose-dependency for observed effects, similar to how dose-dependent effects were demonstrated for Candida peptide derivatives .

  • Competitive inhibition: Use specific antibodies or known substrates to block RBD2 effects.

  • Genetic validation: Confirm in vitro observations with genetic approaches (gene deletion, overexpression) in the relevant Candida species.

  • Substrate specificity analysis: Demonstrate that effects are mediated through specific substrate processing rather than non-specific interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.