Recombinant Candida glabrata Spore membrane assembly protein 2 (SMA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
SMA2; CAGL0L11286g; Spore membrane assembly protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
SMA2
Target Protein Sequence
MLIVKRFILWVLLFFMAITQLLLYLPDFSCSISTGLPLCTPQFNVNIVTGSRTTKDFVSS VRQFLRLISYLAIDMGWSKYLADPHIYNEENLVDTFDTDNLFKINYFGFCKKTSGKTKYC VANGDCGMDVLGILVRDVGLQLGRLTQRYENNTRILGDSLVFTYHLGLSSMRKFLRNDNY RNNAFSKLLLATDDQPYSNTRIKNYAKGVTVAYTLVVVNKIMFYMHLAEITISAAFVVAV LGFGFVLIFGKHHTIMPLLLKGWGSVLMVSSTSSYLATIVYLGTLKLLEPTEMLDTQSQV AGHVLNNDTHSNNWDLLQTTVGSGFVISCFRYIVQCLMLPLVFIAANRYTKAKDFLPAGT EELIKV
Uniprot No.

Target Background

Function
This protein plays a crucial role in spore and ascus formation. It is essential for the efficient assembly of prospore membrane precursors into a continuous prospore membrane.
Database Links
Protein Families
SMA2 family
Subcellular Location
Prospore membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Candida glabrata SMA2 protein?

SMA2 (Spore membrane assembly protein 2) in C. glabrata is a 366-amino acid protein characterized by several transmembrane domains. The full-length protein sequence includes distinct structural regions: a signal peptide at the N-terminus, multiple hydrophobic transmembrane segments, and conserved domains essential for membrane association. According to available sequence data, SMA2 contains specific motifs indicative of membrane localization, including hydrophobic stretches that suggest its integration into cellular membranes .

The amino acid sequence includes notable features such as:

  • N-terminal signal sequence (first 20-25 amino acids)

  • Multiple hydrophobic transmembrane domains

  • Conserved cysteine residues potentially forming disulfide bridges

  • C-terminal cytoplasmic domain with potential regulatory sites

The protein has a complex tertiary structure that enables its function in membrane organization during cell wall remodeling processes.

What expression systems are most effective for producing recombinant SMA2 protein?

Production of functional recombinant SMA2 protein requires careful selection of expression systems that accommodate membrane proteins. The most effective approaches include:

  • Heterologous Yeast Expression Systems: Using S. cerevisiae as an expression host provides the necessary post-translational machinery for proper folding and modification. Vectors containing either ScCEN/ARS or CgCEN/ARS origins of replication can be employed, although growth characteristics may differ between systems .

  • E. coli Expression with Fusion Tags: For partial domain expression, bacterial systems with solubility-enhancing tags (such as MBP or SUMO) can produce manageable quantities of SMA2 fragments for analytical purposes.

  • Baculovirus-Insect Cell Systems: For full-length, properly folded SMA2, insect cell expression often provides superior yields and post-translational modifications compared to bacterial systems.

The expression construct should contain appropriate selection markers (such as LEU2) when working in C. glabrata, though researchers should note this marker may impact growth characteristics as observed in similar systems .

What are the optimal conditions for storing and handling recombinant SMA2 protein?

Recombinant SMA2 protein requires specific storage conditions to maintain stability and functionality:

  • Storage Buffer Composition: The protein demonstrates optimal stability in Tris-based buffers containing 50% glycerol. This formulation prevents freeze-thaw damage and maintains protein conformation .

  • Temperature Considerations: For long-term storage, maintaining the protein at -20°C or preferably -80°C is recommended. Working aliquots can be stored at 4°C for up to one week .

  • Freeze-Thaw Management: Repeated freezing and thawing significantly reduces protein activity. Creating single-use aliquots upon initial thawing is strongly recommended .

  • Working Concentration Preparation: When preparing working dilutions, using buffers with stabilizing agents such as BSA (0.1-0.5%) can improve protein stability during experimental procedures.

The typical quantity provided in commercial preparations (50 μg) is sufficient for multiple experimental applications when properly managed .

What techniques are most effective for studying SMA2 localization in C. glabrata cells?

Investigating SMA2 subcellular localization requires specialized approaches due to its membrane-associated nature:

  • GFP Fusion Protein Analysis: Similar to approaches used for other C. glabrata proteins, SMA2 can be tagged with GFP by constructing fusion proteins expressed under control of constitutive promoters like TEF1. This allows visualization of protein localization under different conditions using fluorescence microscopy .

  • Subcellular Fractionation Protocol:

    • Harvest log-phase C. glabrata cells and suspend in buffer containing protease inhibitors

    • Disrupt cells using ultrasonic disruptor

    • Separate cellular components through differential centrifugation:

      • 1,000g for 3 min to remove unbroken cells

      • 3,000g for 5 min to remove large debris

      • 19,000g for 45 min to isolate membrane fractions

    • Resuspend membrane pellet in storage buffer (10 mM Tris-HCl, 20% glycerol, 0.1 mM EDTA, 0.1 mM dithiothreitol)

    • Quantify protein concentration using Bradford method

  • Immunolocalization Approaches: Using antibodies specific to SMA2 or epitope tags in conjunction with immunofluorescence microscopy or immunoelectron microscopy provides high-resolution localization data.

  • Live-Cell Imaging Techniques: Time-lapse microscopy of GFP-SMA2 allows tracking of dynamic changes in protein distribution during stress responses or cell cycle progression.

How can CRISPR-based techniques be applied to study SMA2 function in C. glabrata?

CRISPR technologies have revolutionized functional studies in C. glabrata, providing powerful approaches for SMA2 investigation:

  • CRISPRi System Application: A CRISPR interference system can be implemented for C. glabrata using modular cloning toolkits to generate selectable phenotypes through single-gRNA targeting . For SMA2 studies, this approach allows:

    • Targeted repression of SMA2 gene expression

    • Temporal control of repression using inducible promoters

    • Analysis of phenotypic effects without complete gene deletion

  • Gene Knockout Strategy: Complete deletion of SMA2 can be achieved through integration of marker genes using homologous recombination methods similar to those employed for other C. glabrata genes:

    • Generate PCR products of marker genes (CgURA3 or CgHIS3) flanked by SMA2 homologous regions

    • Transform into C. glabrata using standard protocols

    • Verify correct integration by genomic PCR and DNA sequencing

  • Complementation Approaches: To confirm phenotype specificity, reintroduce wild-type or mutant versions of SMA2 under control of constitutive promoters like TEF1 .

  • Base Editing Applications: For studying specific amino acid contributions to SMA2 function, CRISPR-based precision editing can introduce point mutations without requiring donor DNA templates.

What transcriptomic approaches are recommended for analyzing SMA2 expression under stress conditions?

Understanding SMA2 expression patterns requires robust transcriptomic methodologies:

  • RNA Isolation Protocol:

    • Incubate C. glabrata cells in appropriate media (YNB or stress conditions)

    • Harvest cells and extract total RNA using specialized kits designed for yeast (e.g., MiniBEST Universal RNA Extraction Kit)

    • Synthesize cDNA using reverse transcription kits (e.g., PrimeScriptTM II 1st Strand cDNA Synthesis Kit)

  • qRT-PCR Analysis:

    • Design primers specific to SMA2 and reference genes

    • Perform qRT-PCR using SYBR-based systems

    • Normalize expression data using appropriate housekeeping genes (e.g., actin)

    • Run experiments in triplicate to ensure statistical reliability

  • RNA-Seq Approaches:

    • Compare transcriptional profiles between wild-type and mutant strains under multiple conditions

    • Identify genes co-regulated with SMA2

    • Perform GO term enrichment analysis to identify biological processes associated with SMA2 expression changes

    • Use differential expression analysis to identify transcriptional rewiring under specific conditions

This comprehensive approach can reveal how SMA2 expression integrates into broader cellular stress responses, particularly in relation to membrane integrity and cell wall organization.

How does SMA2 contribute to C. glabrata stress response mechanisms?

While direct evidence for SMA2's role in stress response is limited in the provided data, methodological approaches for investigating its involvement include:

  • Growth Phenotype Analysis:

    • Test growth of wild-type vs. SMA2 mutant strains on media with various stressors:

      • pH ranges (2.0-9.0)

      • Carbon sources (glucose, acetate, ethanol)

      • Cell wall stressors (Calcofluor White, Congo Red)

      • Oxidative stress agents (H₂O₂, menadione)

    • Quantify growth curves using OD measurements at appropriate wavelengths

    • Assess colony formation efficiency under different stress conditions

  • Intracellular pH Measurement:

    • Use pH-sensitive fluorescent probes to quantify intracellular pH in wild-type vs. SMA2 mutant strains

    • Monitor pH changes in response to environmental pH shifts

    • Compare results to known pH regulation mutants (e.g., Cgasg1Δ, Cghal9Δ)

  • ROS Detection and Quantification:

    • Measure intracellular reactive oxygen species using fluorescent indicators

    • Compare ROS levels between wild-type and SMA2 mutants under stress conditions

    • Analyze the relationship between membrane integrity, ROS production, and SMA2 function

What protein-protein interaction methods are most suitable for identifying SMA2 binding partners?

Elucidating SMA2 interaction networks requires specialized approaches for membrane proteins:

  • Membrane-Based Yeast Two-Hybrid (MYTH) System:

    • Construct bait vectors expressing SMA2 fused to the C-terminal fragment of ubiquitin

    • Screen against prey libraries expressing potential interactors fused to transcription factors

    • Identify positive interactions through reporter gene activation

    • Validate interactions using orthogonal methods

  • Co-Immunoprecipitation Protocol:

    • Express epitope-tagged SMA2 in C. glabrata

    • Prepare membrane fractions using differential centrifugation

    • Solubilize membranes with appropriate detergents

    • Immunoprecipitate SMA2 complexes using anti-tag antibodies

    • Identify interacting partners by mass spectrometry

  • Proximity-Dependent Biotin Identification (BioID):

    • Generate SMA2 fusions with promiscuous biotin ligase

    • Express in C. glabrata and activate biotinylation

    • Purify biotinylated proteins using streptavidin

    • Identify proximal proteins by mass spectrometry

These complementary approaches can reveal both stable and transient interactions, providing insight into SMA2's functional networks.

How do SMA2 homologs differ across Candida species, and what methods best reveal evolutionary relationships?

Investigating evolutionary aspects of SMA2 requires comparative genomic and functional approaches:

  • Sequence Analysis Pipeline:

    • Identify SMA2 homologs across fungal genomes using BLAST searches

    • Align sequences using MUSCLE or MAFFT algorithms

    • Construct phylogenetic trees using maximum likelihood methods

    • Identify conserved domains and species-specific variations

  • Functional Complementation Testing:

    • Express SMA2 homologs from different species in C. glabrata SMA2 mutants

    • Assess restoration of phenotypes under various conditions

    • Quantify complementation efficiency through growth rates and stress resistance

  • Domain Swap Experiments:

    • Create chimeric proteins with domains from different species' SMA2 homologs

    • Express in appropriate mutant backgrounds

    • Determine which domains confer species-specific functions

  • Comparative Expression Analysis:

    • Compare transcriptional regulation of SMA2 homologs across species

    • Identify conserved and divergent regulatory elements

    • Correlate expression patterns with species-specific phenotypes

This evolutionary perspective can provide insight into how membrane assembly functions have adapted across fungal lineages with different lifestyles and host associations.

What methodological considerations are important when designing SMA2 mutant studies?

Creating and analyzing SMA2 mutations requires careful experimental design:

  • Mutation Selection Strategy:

    • Target conserved residues identified through sequence alignment

    • Focus on predicted functional domains (membrane-spanning regions, cytoplasmic loops)

    • Consider charge, hydrophobicity, and size when selecting amino acid substitutions

    • Implement scanning mutagenesis approaches for comprehensive functional mapping

  • Expression Control Considerations:

    • Express mutant versions under native or constitutive promoters depending on experimental goals

    • Consider using inducible systems for potentially lethal mutations

    • Verify expression levels through western blotting or RT-qPCR to ensure phenotypes are not due to expression differences

  • Phenotypic Analysis Matrix:

    Mutation TypeGrowth AnalysisLocalizationStress ResponseProtein Interaction
    TransmembraneCell viability, colony morphologyGFP fusion imagingpH, oxidative, cell wall stressMYTH or BioID
    Cytoplasmic domainGrowth rate, cell cycleFractionationROS measurement, pH homeostasisCo-IP, pull-down
    Conserved motifsComplementation efficiencyTime-lapse microscopyEnvironmental adaptationCrosslinking studies
  • Double Mutant Analysis:

    • Create combinations of SMA2 mutations with other genes (e.g., ASG1, HAL9)

    • Assess genetic interactions through epistasis analysis

    • Identify synthetic lethal or suppressor relationships

These methodological approaches provide a comprehensive framework for dissecting SMA2 function through targeted mutagenesis.

How can researchers effectively use antibodies and immunological methods to study SMA2?

Immunological approaches for membrane protein research require specific considerations:

  • Antibody Development Strategy:

    • Select antigenic regions of SMA2 (preferably extracellular loops or cytoplasmic domains)

    • Synthesize peptides or express protein fragments as immunogens

    • Develop polyclonal antibodies in rabbits or monoclonal antibodies using hybridoma technology

    • Validate antibody specificity using SMA2 knockout strains

  • Immunoblotting Protocol Optimization:

    • Extract membrane proteins using specialized buffers containing appropriate detergents

    • Optimize SDS-PAGE conditions for membrane proteins (sample heating temperature, SDS concentration)

    • Use wet transfer methods with optimized buffer compositions for membrane proteins

    • Block with protein-free blocking buffers to reduce background

  • Immunofluorescence Microscopy Approach:

    • Fix cells with methods preserving membrane structure (e.g., paraformaldehyde followed by gentle permeabilization)

    • Apply primary antibodies against SMA2 or epitope tags

    • Use fluorophore-conjugated secondary antibodies for detection

    • Employ confocal microscopy for precise localization

These immunological methods complement genetic and biochemical approaches to provide multi-dimensional insights into SMA2 biology.

What considerations are important when designing ELISA-based approaches for quantifying SMA2 expression?

ELISA development for membrane proteins like SMA2 requires specific technical adaptations:

  • Sample Preparation Protocol:

    • Fractionate cells to isolate membrane components

    • Solubilize membranes using mild detergents that maintain protein conformation

    • Standardize protein concentration using Bradford or BCA assays

    • Store samples in stabilizing buffers with protease inhibitors

  • ELISA Format Selection:

    • Sandwich ELISA: Use capture antibodies against SMA2 and detection antibodies against epitope tags

    • Direct ELISA: Immobilize solubilized membranes and detect SMA2 directly

    • Competitive ELISA: For quantification in complex samples

  • Calibration and Standardization:

    • Use recombinant SMA2 protein as standard

    • Create standard curves covering physiological concentration ranges

    • Include positive and negative control samples in each assay

    • Normalize results to total membrane protein content

  • Assay Validation Parameters:

    • Determine limits of detection and quantification

    • Assess intra- and inter-assay variability

    • Verify specificity using knockout strains

    • Test linearity, recovery, and parallelism

These considerations ensure robust, reproducible quantification of SMA2 protein levels across experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.