Recombinant Candida glabrata Squalene monooxygenase (ERG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ERG1; CAGL0D05940g; Squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ERG1
Target Protein Sequence
MSLTNADETVTYDALIVGAGVIGPCVATALARKGKKVLIVEREWSQPDRIVGELMQPGGL RALRSLGMIQSINNIDAYPVTGYTVFYNGEHVDIPYPYKADLKPVEKLPGLVRDGNDKVL EDATVHKKDFEDDERERGVGLVHGRFLNNLRNICAAEPNVTRLQGNVVEILKDKKNEVVG AKVDVDSRGKVDFKAHLTFVCDGIFSRFRRELHPDHVPTVNSSFVGMSLYHAHMPHDMHG HVILGDKHMPILVYQISPEETRILCAYNAPKVPTDLKSWMTKDVQPYIPKTLRPSFDDAL AQGKFKPMANSWLPARQNDVTGLCVIGDALNMRHPLTGGGMTVGLNDVVLLIKKIGDLDF SDREKVLDELLDYHFERKNYDAVVNVLSISLYSLFAADSKNLKALQKGCFKYFQRGGDCV NLPVAFLAGVLPKPLLLTRVFFAVAFYTIYLNMEERGFLGLPMALLEGIMILITAIKVFT PFLVRELIG
Uniprot No.

Target Background

Function
Recombinant *Candida glabrata* Squalene monooxygenase (ERG1) catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This enzyme is considered rate-limiting in steroid biosynthesis.
Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Candida glabrata ERG1?

Candida glabrata ERG1 (CgERG1) encodes a 489-amino-acid protein that functions as a squalene epoxidase essential for ergosterol biosynthesis. Based on homology with Saccharomyces cerevisiae ERG1, this enzyme catalyzes the conversion of squalene to squalene epoxide, a critical step in the ergosterol biosynthetic pathway .

The protein shares significant structural homology with other fungal squalene epoxidases but contains species-specific regions that may account for differences in enzyme activity and antifungal drug interactions. The crystal structure has not been fully resolved, but functional domains include a flavin adenine dinucleotide (FAD) binding domain and a substrate-binding pocket that interacts with both squalene and various antifungal compounds.

How does ERG1 contribute to ergosterol biosynthesis in Candida glabrata?

ERG1 catalyzes a rate-limiting step in ergosterol biosynthesis, converting squalene to 2,3-oxidosqualene through an epoxidation reaction. This reaction requires molecular oxygen and NADPH as cofactors. In C. glabrata mutants with disrupted ERG1 function (such as CgTn201S with interruption following codon 475), studies have observed:

  • 50% reduction in total ergosterol content

  • Accumulation of the squalene precursor

  • Impaired growth, particularly under low oxygen conditions

  • Increased uptake of exogenous sterols like cholesterol

These observations confirm that ERG1 is essential for maintaining normal ergosterol levels, which are crucial for membrane integrity and function in C. glabrata.

What distinguishes C. glabrata ERG1 from orthologous proteins in other fungal species?

While C. glabrata ERG1 shares functional similarities with other fungal squalene epoxidases, several distinguishing features have been identified:

  • Sequence variations in the C-terminal region appear to influence enzyme stability and activity

  • The substrate-binding pocket configuration may contribute to species-specific differences in antifungal drug susceptibility

  • Unlike some other Candida species, disruption of ERG1 in C. glabrata still allows for uptake of exogenous sterols under aerobic conditions (CgTn201S incorporated cholesterol constituting 34% of extractable sterols when grown on serum-containing medium)

This capacity for sterol uptake may contribute to C. glabrata's ability to survive in different host environments and under antifungal pressure.

What are the optimal methods for cloning and expressing recombinant C. glabrata ERG1?

Based on successful experimental approaches, the following methodology is recommended for cloning and expressing recombinant C. glabrata ERG1:

  • PCR amplification of the CgERG1 gene (2.2 kb) using high-fidelity polymerase such as PfuUltra DNA polymerase

  • Recommended primer design:

    • Forward primer: 5′-TAGAGACCACTTCGGTCAAG-3′

    • Reverse primer: 5′-TTTCTATTGTGTGAGGAAATG-3′

  • PCR conditions:

    • Initial denaturation: 94°C for 2 min

    • 30 cycles of: 94°C for 30s, 53°C for 30s, 72°C for 2 min 30s

    • Final extension: 72°C for 10 min

  • Cloning strategies:

    • Direct cloning into expression vectors using appropriate restriction sites

    • Alternatively, use of TOPO-TA or similar cloning systems for initial cloning, followed by subcloning into expression vectors

    • Successful expression has been reported in both E. coli and yeast expression systems

For expression in yeast systems, vectors containing constitutive promoters like TDH3 have shown good results for ERG genes .

How can researchers effectively create and characterize C. glabrata ERG1 mutants?

Creating targeted mutations in C. glabrata ERG1 can be accomplished through several approaches:

  • Transposon mutagenesis:

    • Has been successfully used to generate CgERG1 mutants such as CgTn201S

    • Allows for random insertional mutagenesis followed by selection for phenotypes of interest (e.g., increased fluconazole susceptibility)

  • CRISPR-Cas9 gene editing:

    • Provides precise targeting for specific amino acid substitutions

    • Requires optimization of guide RNA design for C. glabrata

  • Homologous recombination:

    • Using selectable markers (e.g., URA3) for integration and counter-selection

    • Construction of replacement cassettes with desired mutations

For characterization, a comprehensive approach should include:

  • Sterol profile analysis using GC-MS to quantify ergosterol content and precursor accumulation

  • Growth assays under various conditions (aerobic, hypoxic, with/without exogenous sterols)

  • Antifungal susceptibility testing against multiple drug classes

  • Drug uptake assays using labeled compounds (e.g., [3H]-fluconazole)

  • Complementation studies using wild-type CgERG1 to confirm phenotype specificity

What expression systems are most effective for producing functional recombinant C. glabrata ERG1?

When selecting an expression system for recombinant C. glabrata ERG1, consider the following options and their advantages:

  • Homologous expression in C. glabrata:

    • Maintains native post-translational modifications

    • Can utilize vectors like pCgACU with appropriate selectable markers

    • Complementation can be confirmed in ERG1-disrupted strains such as CgTn201S

  • Expression in S. cerevisiae:

    • Well-established yeast expression systems

    • Similar cellular environment to native host

    • Easier genetic manipulation than C. glabrata

    • Successfully used for expressing orthologous ERG genes

  • Heterologous expression in E. coli:

    • Higher protein yields

    • Potential issues with protein folding and lack of post-translational modifications

    • May require optimization of codon usage for efficient expression

For functional studies, expression in yeast systems generally provides more physiologically relevant results. Based on available research, complementation of ergosterol pathway mutants provides the most reliable indication of functional expression.

How do mutations in C. glabrata ERG1 affect antifungal susceptibility profiles?

Mutations in C. glabrata ERG1 can significantly alter antifungal susceptibility profiles through multiple mechanisms. The CgTn201S mutant with disruption following codon 475 demonstrated:

  • Increased susceptibility to:

    • Fluconazole

    • Itraconazole

    • Terbinafine

  • Increased resistance to:

    • Amphotericin B

These altered susceptibility profiles result from:

  • Reduced ergosterol content (50% decrease) affecting membrane integrity

  • Accumulation of squalene, altering membrane fluidity

  • Increased drug uptake, as evidenced by higher levels of rhodamine 6G and [3H]-fluconazole accumulation

  • Potential compensatory changes in expression of other ERG genes

  • Changes in efflux pump activity and drug transport mechanisms

The relationship between ERG1 mutations and azole susceptibility appears to be complex and may involve cross-talk with other resistance mechanisms, including activation of transcription factors like Pdr1 that regulate drug efflux pumps.

What is the relationship between ERG1 function and oxygen tension in C. glabrata?

ERG1 function in C. glabrata is intricately connected to oxygen tension, with significant implications for fungal survival in different host environments:

  • Under normal aerobic conditions:

    • ERG1 functions efficiently to catalyze the oxygen-dependent conversion of squalene to squalene epoxide

    • This maintains normal ergosterol levels and membrane function

  • Under low oxygen tension:

    • CgERG1 mutants (e.g., CgTn201S) show blocked growth

    • Wild-type strains adjust ERG gene expression to adapt to reduced oxygen availability

    • Transcription factors like Hap1A and Hap1B modulate ERG gene expression under hypoxic conditions

  • Relationship with sterol uptake:

    • CgTn201S efficiently takes up exogenous cholesterol from serum (constituting 34% of extractable sterols)

    • Exogenous sterols can restore growth under low oxygen conditions

    • This adaptation may be relevant for survival in hypoxic host environments

This relationship highlights the adaptive strategies of C. glabrata to survive in diverse host niches with varying oxygen availability, which may contribute to its pathogenicity and antifungal resistance.

How does the regulation of ERG1 expression interact with other resistance mechanisms in C. glabrata?

The regulation of ERG1 expression in C. glabrata interacts with multiple resistance mechanisms, creating a complex network that contributes to antifungal resistance:

  • Transcription factor interactions:

    • Zinc cluster transcription factors Hap1A and Hap1B directly regulate ERG gene expression under different conditions

    • Hap1B deletion results in increased azole susceptibility due to decreased azole-induced expression of ERG genes and reduced ergosterol levels

    • Hap1A is specifically induced under hypoxic conditions, where it represses ERG genes

  • Cross-talk with PDR1 pathway:

    • Mutations in ergosterol biosynthesis genes can activate the Pdr1 transcription factor

    • Pdr1 regulates numerous genes involved in drug resistance, including efflux pumps

    • This creates a feedback loop where alterations in ERG gene function can trigger broader resistance mechanisms

  • Compensatory ERG pathway regulation:

    • Inhibition of one step in the ergosterol pathway often leads to upregulation of other pathway enzymes

    • This coordinated regulation helps maintain membrane integrity under stress conditions

This interconnected regulatory network enables C. glabrata to rapidly adapt to antifungal pressure through multiple mechanisms, highlighting the challenges in developing effective treatments against this pathogen.

How do ERG1 mutations contribute to clinical antifungal resistance in C. glabrata infections?

ERG1 mutations contribute to clinical antifungal resistance in C. glabrata infections through several mechanisms with important therapeutic implications:

  • Direct effects on drug target availability:

    • Altered ERG1 function changes the sterol composition of fungal membranes

    • Reduced ergosterol content (as seen in CgTn201S mutant) can increase resistance to amphotericin B, which targets ergosterol directly

  • Secondary activation of efflux mechanisms:

    • ERG1 mutations can trigger activation of the Pdr1 transcription factor

    • This leads to upregulation of drug efflux pumps and multidrug resistance

  • Altered growth characteristics:

    • ERG1 mutants show reduced growth rates but can survive in host environments

    • This persistence despite slower growth may contribute to treatment failures

    • Ability to utilize host sterols enables survival despite impaired ergosterol synthesis

  • Environmental adaptation:

    • C. glabrata can adapt to different oxygen tensions through regulation of ERG genes

    • This ability to survive in diverse host niches may contribute to persistent infections despite treatment

The clinical significance of these mechanisms is evidenced by the emergence of resistant C. glabrata isolates in patients undergoing prolonged azole therapy, with substantial increases in resistance levels observed.

What considerations should be made when targeting ERG1 for novel antifungal development?

When considering ERG1 as a target for novel antifungal development, researchers should address several key factors:

  • Target validation considerations:

    • ERG1 is essential for normal growth and ergosterol biosynthesis in C. glabrata

    • Inhibition leads to altered membrane composition and function

    • The enzyme has no direct human homolog, offering potential selectivity

  • Potential resistance mechanisms to anticipate:

    • Compensatory upregulation of other ERG genes

    • Activation of Pdr1-mediated efflux mechanisms

    • Utilization of exogenous sterols from host environments

    • Mutations in drug-binding sites reducing inhibitor affinity

  • Structure-activity relationship considerations:

    • Target the highly conserved catalytic site for broad-spectrum activity

    • Consider species-specific differences in substrate-binding pocket

    • Assess activity under different oxygen tensions, as ERG1 function is oxygen-dependent

    • Design inhibitors that prevent compensatory resistance mechanisms

  • Combination therapy approaches:

    • Pair ERG1 inhibitors with efflux pump inhibitors to prevent resistance

    • Consider dual targeting of multiple steps in the ergosterol pathway

    • Evaluate synergy with existing antifungal classes

The most promising approach may be developing molecules that both inhibit ERG1 and disrupt the activation of compensatory resistance mechanisms, particularly those involving transcription factors like Pdr1 and Hap1B .

What are common challenges when working with recombinant C. glabrata ERG1 and how can they be addressed?

Researchers working with recombinant C. glabrata ERG1 may encounter several challenges:

  • Protein expression and solubility issues:

    • Challenge: Membrane-associated proteins like ERG1 often have solubility issues

    • Solution: Use mild detergents (0.1% Triton X-100 or low concentrations of CHAPS) during protein extraction

    • Alternative: Express truncated versions retaining catalytic activity but improved solubility

  • Enzyme activity assessment:

    • Challenge: Direct measurement of squalene epoxidase activity is technically demanding

    • Solution: Use complementation of ERG1 mutants as a functional readout

    • Alternative: Develop GC-MS based assays to measure conversion of squalene to 2,3-oxidosqualene

  • Genetic manipulation difficulties:

    • Challenge: C. glabrata has lower transformation efficiency than S. cerevisiae

    • Solution: Optimize electroporation protocols specifically for C. glabrata

    • Alternative: Use E. coli-based rescue cloning approaches as demonstrated with the CgTn201S mutant

  • Phenotypic verification:

    • Challenge: Confirming ERG1 function through phenotypic analysis

    • Solution: Use complementation studies in ERG1-disrupted strains

    • Approach: Test growth under different oxygen tensions and in the presence of various antifungals

    • Verification: Analyze sterol profiles to confirm restoration of normal ergosterol synthesis

What experimental controls are essential when studying C. glabrata ERG1 function and regulation?

When investigating C. glabrata ERG1 function and regulation, the following experimental controls are essential:

  • Genetic complementation controls:

    • Wild-type ERG1 expression in mutant strains to confirm phenotype specificity

    • Empty vector controls to rule out vector-mediated effects

    • Complementation with known non-functional ERG1 mutants as negative controls

  • Growth condition controls:

    • Parallel experiments under aerobic and hypoxic conditions

    • Media with and without exogenous sterols (e.g., serum-containing media)

    • Growth temperature variations to assess temperature-sensitive phenotypes

  • Drug susceptibility testing controls:

    • Include reference strains with known susceptibility profiles

    • Test multiple drug classes (azoles, polyenes, echinocandins)

    • Include control strains with known resistance mechanisms (e.g., Pdr1 hyperactive mutants)

  • Transcriptional regulation studies:

    • Assess ERG1 expression alongside other ERG genes to understand coordinated regulation

    • Include transcription factor mutants (e.g., hap1AΔ, hap1BΔ) to understand regulatory networks

    • Time-course experiments to capture dynamic regulatory responses

  • Sterol analysis controls:

    • Include standards for all expected sterols

    • Compare profiles between wild-type, mutant, and complemented strains

    • Assess sterol profiles under different growth conditions

These comprehensive controls ensure reliable interpretation of results and differentiation between direct ERG1-mediated effects and secondary consequences.

How can researchers effectively analyze the impact of ERG1 variants on sterol profiles and membrane function?

A comprehensive approach to analyzing the impact of ERG1 variants on sterol profiles and membrane function should include:

  • Sterol extraction and analysis:

    • Optimized extraction protocol:

      • Saponification with alcoholic KOH

      • Extraction with petroleum ether

      • Derivatization (if needed) for improved GC-MS detection

    • Analytical methods:

      • Gas chromatography-mass spectrometry (GC-MS) for quantitative sterol profiling

      • Comparison of ergosterol content and precursor accumulation patterns

      • Detection of alternate sterols (e.g., cholesterol uptake from medium)

  • Membrane integrity and function assays:

    • Fluorescent dye uptake (e.g., propidium iodide) to assess membrane permeability

    • Membrane fluidity measurements using fluorescence anisotropy

    • Assessment of plasma membrane H⁺-ATPase activity as a marker of membrane function

  • Drug interaction studies:

    • Rhodamine 6G accumulation assays to assess drug uptake and efflux

    • [³H]-fluconazole accumulation studies to directly measure azole transport

    • Checkerboard assays to evaluate interactions between different antifungal classes

  • Growth and fitness assessment:

    • Growth curve analysis under different oxygen tensions

    • Competition assays with wild-type strains to assess fitness costs

    • Survival under stress conditions (oxidative stress, osmotic stress)

    • Growth in the presence or absence of exogenous sterols

What are the most promising future research directions for C. glabrata ERG1 studies?

The study of C. glabrata ERG1 remains an active and promising field with several key research directions that could advance our understanding of fungal biology and improve antifungal therapies:

  • Structural biology approaches:

    • Determining the crystal structure of C. glabrata ERG1 would facilitate rational drug design

    • Comparative structural analysis with orthologs could identify species-specific features

    • Structure-function studies to map the precise molecular interactions with inhibitors

  • Regulatory network mapping:

    • Further elucidation of the interplay between ERG1, other ERG genes, and transcription factors like Hap1A/B

    • Investigation of oxygen-sensing mechanisms that modulate ERG1 expression

    • Systems biology approaches to model the complex resistance networks

  • Host-pathogen interactions:

    • Understanding how ERG1 function and sterol composition affect immune recognition

    • Investigating ERG1 regulation during different stages of infection

    • Exploring how sterol uptake from host environments influences pathogenesis

  • Translational applications:

    • Development of ERG1 inhibitors that prevent compensatory resistance mechanisms

    • Exploration of combination therapies targeting ERG1 alongside efflux mechanisms

    • Diagnostic applications to rapidly identify resistance-associated ERG1 variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.