Recombinant Candida glabrata Squalene synthase (ERG9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG9; CAGL0M07095g; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ERG9
Target Protein Sequence
MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYELLNLTSRSFAAVIMEL HPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLDTTDWSFDGNDLKEKDR VVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDENFNLNGVQTVKDYDKYCH YVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMGLFLQKTNIIRDYAEDLDDGRSF WPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVIDVLTYLSSIHEQSSFQFCA IPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRTLKGCVDIFQYYLRDMKQRLP VEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMIYLKVQERLKWDTQVIPRVQEE DYKFNMALSVVFCVLLSFYFFTK
Uniprot No.

Target Background

Function

Recombinant Candida glabrata Squalene Synthase (ERG9): This enzyme catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene, a crucial step in sterol biosynthesis. It's the first committed enzyme in this pathway and is essential for ergosterol biosynthesis.

Database Links
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of squalene synthase (ERG9) in Candida glabrata metabolism?

Squalene synthase (encoded by the ERG9 gene) serves as the first committed enzyme in the sterol biosynthesis pathway in Candida glabrata. This enzyme catalyzes the conversion of farnesyl diphosphate to squalene, a crucial precursor for ergosterol biosynthesis. Ergosterol is the fungal equivalent of cholesterol in mammalian cells and is essential for fungal membrane integrity and function. The enzyme is formally classified as farnesyl-diphosphate farnesyltransferase (EC 2.5.1.21) and plays a vital role in fungal cell viability under standard laboratory conditions .

How was the ERG9 gene identified and characterized in C. glabrata?

The ERG9 gene in C. glabrata was identified through a combination of PCR-based techniques and genomic library screening. Researchers designed degenerate primers corresponding to conserved regions of squalene synthase genes from five other species (S. cerevisiae, C. albicans, S. pombe, humans, and A. thaliana). These primers successfully amplified an approximately 400-bp fragment from C. glabrata genomic DNA. The central portion of this PCR fragment was then used as a probe to screen a C. glabrata genomic library. Thirteen hybridization-positive clones were obtained from approximately 100,000 colonies, and their DNA sequences were determined by primer walking. The primers used for initial amplification were ERG9-2 (5′-TAYTGYCAYTAYGTIGCIGGIYTIGTIGG-3′) and ERG9-4RV (5′-ATIGCCATIACYTGIGGDATIGCRCARAA-3′) .

What expression systems are most effective for producing recombinant C. glabrata ERG9 protein?

The most successful expression system documented for recombinant C. glabrata ERG9 utilizes Escherichia coli as the host organism. The full-length protein (amino acids 1-443) can be expressed with an N-terminal His-tag to facilitate purification. The recombinant protein is typically produced as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. For optimal protein quality, the storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

When working with the recombinant protein, consider the following handling parameters:

ParameterRecommended Condition
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term storageAdd 5-50% glycerol, store at -20°C/-80°C
Working aliquotsStore at 4°C for up to one week
Critical noteAvoid repeated freeze-thaw cycles

Expression of membrane-associated enzymes like squalene synthase often presents challenges related to protein solubility and proper folding, which may necessitate optimization of expression conditions .

How can tetracycline-regulatable promoter systems be optimized to study ERG9 function?

Tetracycline-regulatable promoter systems have proven valuable for studying ERG9 function in C. glabrata. To implement this approach, researchers have constructed a plasmid (p97ERG9) by introducing specific regions of the ERG9 gene into a vector containing the tetracycline-regulatable promoter (97t). The endogenous ERG9 promoter is then replaced with this regulatable promoter through homologous recombination .

The key regions and primers used in this construction include:

  • Region A (nt -503 to -133): Amplified with primers ERG9AF (5′-CAGTCTCCGCGGCCACAATGGACTCCGGG-3′) and ERG9AR (5′-ACAGCATCTAGAGGACTTCGAAGTTTATGCTC-3′)

  • Region B (nt -6 to 314): Amplified with primers ERG9BF (5′-AAAAATGAATTCATAACCATGGGTAAAGTACTTG-3′) and ERG9BR (5′-GGAGTCGTCGACACGCAACACTTTGACCTTC-3′)

To optimize this system, consider the following:

  • Titrate doxycycline concentrations to achieve the desired level of gene repression

  • Verify ERG9 expression levels using qRT-PCR or Western blotting

  • Monitor sterol composition to confirm functional consequences of ERG9 depletion

  • Test expression kinetics at different time points after doxycycline addition

What methods are most reliable for analyzing the consequences of ERG9 depletion?

When studying the effects of ERG9 depletion, several complementary analytical approaches should be employed:

Why does ERG9 depletion affect C. glabrata differently in vitro versus in vivo?

This finding has profound implications for antifungal drug development, as it indicates that even complete inhibition of squalene synthase would likely be ineffective in treating C. glabrata infections due to the pathogen's ability to utilize host cholesterol.

How do mutations in sterol biosynthesis genes, including ERG9, contribute to antifungal resistance?

Mutations in sterol biosynthesis genes have been implicated in antifungal resistance in C. glabrata. Analysis of clinical isolates has identified specific mutations in ERG9 and other sterol pathway genes. For example, one study found a non-synonymous mutation in ERG9 (C128F) in a non-resistant strain (CMRL5) . While the direct contribution of this specific mutation to resistance was not explicitly stated, alterations in sterol biosynthesis genes can potentially impact susceptibility to antifungal drugs.

The relationship between sterol pathway mutations and resistance is complex, often involving multiple genes. For instance, mutations in PDR1, which encodes a transcription factor regulating drug efflux pumps, have been found in azole-resistant strains (e.g., R376Q mutation) . Additionally, mutations in FKS1 and FKS2 genes have been associated with echinocandin resistance .

The potential mechanisms by which ERG9 mutations might contribute to resistance include:

  • Altered sterol composition affecting membrane properties

  • Changes in the flux through the ergosterol biosynthesis pathway

  • Compensatory adaptations in response to pathway disruption

  • Enhanced ability to utilize exogenous sterols

What implications does the cholesterol uptake mechanism have for antifungal drug development?

This finding challenges a previously promising approach to antifungal therapy and highlights important considerations for future drug development:

  • Target validation should include in vivo studies to account for adaptive mechanisms that may not be apparent in laboratory conditions.

  • Ideal antifungal targets should be essential processes that cannot be circumvented by utilizing host resources.

  • Combination therapies might be needed to simultaneously inhibit both endogenous sterol synthesis and exogenous sterol uptake.

  • Understanding the molecular mechanisms of cholesterol uptake and utilization in C. glabrata could reveal novel therapeutic targets.

The cholesterol uptake mechanism represents both a challenge for current antifungal strategies and an opportunity for developing innovative approaches that target this adaptive response.

What are the key technical challenges in studying recombinant ERG9 protein activity?

Studying recombinant ERG9 protein activity presents several technical challenges that researchers should address:

  • Membrane association: Squalene synthase contains hydrophobic domains that can complicate expression, purification, and activity assays. To overcome this, consider using detergents or lipid reconstitution systems to maintain proper protein folding and activity.

  • Enzyme stability: The recommendation to avoid repeated freeze-thaw cycles for recombinant ERG9 suggests stability issues . The inclusion of 6% trehalose in the storage buffer helps stabilize the protein structure, and adding glycerol (5-50%) for long-term storage can further prevent denaturation.

  • Substrate availability: The natural substrate, farnesyl diphosphate, may have limited commercial availability or stability. Consider synthesizing the substrate or using stable analogs for activity assays.

  • Assay development: Direct measurement of squalene formation requires specialized analytical techniques. Common approaches include:

    • Radiolabeled substrate assays with TLC or HPLC detection

    • Coupled enzyme assays measuring pyrophosphate release

    • Mass spectrometry-based detection of reaction products

How can researchers reconcile contradictory findings regarding ERG9 as an antifungal target?

The contradictory findings regarding ERG9 as an antifungal target stem primarily from differences between in vitro and in vivo conditions. To reconcile these contradictions, researchers should:

  • Use physiologically relevant conditions: Test potential ERG9 inhibitors in media supplemented with serum or cholesterol to better mimic in vivo conditions. This approach would reveal whether compounds maintain activity despite the presence of exogenous sterols .

  • Employ genetic and chemical approaches in parallel: Compare results from genetic depletion studies (e.g., using tetracycline-regulatable promoters) with those from chemical inhibition to distinguish between consequences of protein absence versus loss of catalytic activity.

  • Consider species differences: The ability to utilize exogenous sterols may vary among fungal pathogens. Compare results across multiple Candida species and other pathogenic fungi to identify species-specific differences that might influence target viability.

  • Investigate combination approaches: Test ERG9 inhibitors in combination with compounds that might block cholesterol uptake or utilization to determine whether this strategy could overcome the adaptive mechanism observed in vivo.

  • Perform detailed sterol profiling: Analyze the complete sterol composition of cells under various conditions to gain insights into the metabolic adaptations that occur in response to ERG9 inhibition .

What controls should be included when evaluating the effects of ERG9 depletion or inhibition?

When studying ERG9 depletion or inhibition, several key controls should be included to ensure robust and interpretable results:

  • Growth conditions controls:

    • Media with and without serum supplementation

    • Media with defined sterol composition (e.g., with added ergosterol or cholesterol)

    • Comparison of laboratory versus host-mimicking conditions

  • Genetic controls:

    • Wild-type parental strain

    • Strain with regulatable promoter but without doxycycline induction

    • Complemented strain expressing ERG9 from an alternative promoter

    • Strains with mutations in other sterol pathway enzymes for comparison

  • Chemical controls:

    • Vehicle control for inhibitor studies

    • Known inhibitors of other steps in the sterol pathway

    • Compounds affecting sterol uptake or transport

  • Analytical controls:

    • Standards for sterol analysis (ergosterol, cholesterol, pathway intermediates)

    • Time course measurements to capture dynamic responses

    • Parallel measurements of gene expression, protein levels, and metabolic outcomes

  • In vivo controls:

    • Comparison of multiple infection routes or models

    • Assessment of fungal burden at different time points

    • Analysis of fungal cells recovered from different host tissues or compartments

What research questions remain regarding C. glabrata's ability to use exogenous sterols?

Despite the important findings regarding C. glabrata's ability to use exogenous sterols when ERG9 is inhibited, several critical questions remain:

  • What are the molecular mechanisms of cholesterol uptake in C. glabrata? Identifying the transporters or receptors involved could reveal new therapeutic targets.

  • How does C. glabrata convert or modify host cholesterol for integration into fungal membranes? Understanding these modifications might explain how a cholesterol-based membrane can substitute for an ergosterol-based one.

  • Are there tissue-specific differences in C. glabrata's ability to utilize host sterols? Certain infection sites might have limited cholesterol availability, potentially preserving ERG9 as a viable target in those specific contexts.

  • Does the use of exogenous sterols affect C. glabrata virulence or host immune recognition? Changes in membrane composition might alter host-pathogen interactions.

  • How conserved is this adaptive mechanism across different C. glabrata strains and other Candida species? Strain-specific or species-specific differences could influence treatment strategies.

How might genome editing techniques advance our understanding of ERG9 function?

Modern genome editing techniques offer powerful approaches to further elucidate ERG9 function and regulation in C. glabrata:

  • CRISPR-Cas9 gene editing could be used to:

    • Create precise point mutations that affect specific functional domains

    • Generate conditional knockouts with improved temporal control

    • Introduce reporter tags to monitor protein localization and dynamics

    • Modify the promoter region to study transcriptional regulation

  • Site-directed mutagenesis could target:

    • Residues identified in clinical isolates, such as the C128F mutation

    • Conserved catalytic residues to study structure-function relationships

    • Potential regulatory sites for post-translational modifications

  • Fluorescent protein fusions would allow:

    • Real-time monitoring of ERG9 expression and localization

    • Investigation of protein-protein interactions within the sterol biosynthesis pathway

    • Analysis of changes in expression or localization in response to antifungal stress

  • Comparative genomics approaches comparing ERG9 and its regulation across multiple clinical isolates could reveal adaptations associated with antifungal resistance or virulence.

What alternative approaches might circumvent C. glabrata's ability to utilize host cholesterol?

Given C. glabrata's ability to utilize host cholesterol when ERG9 is inhibited, alternative therapeutic approaches might include:

  • Dual-targeting strategies:

    • Simultaneously inhibiting both ERG9 and the mechanisms of cholesterol uptake or utilization

    • Combining sterol biosynthesis inhibitors with compounds that disrupt membrane integrity

  • Targeting downstream steps:

    • Identifying steps in the sterol pathway that remain essential even when exogenous cholesterol is available

    • Focusing on enzymes that might be involved in modifying incorporated cholesterol

  • Exploiting metabolic consequences:

    • Targeting processes that become vulnerable when cells switch from ergosterol to cholesterol

    • Identifying synthetic lethal interactions with the cholesterol utilization pathway

  • Host-directed therapies:

    • Modulating host cholesterol availability in infection sites

    • Targeting host-pathogen interactions that might be altered by changes in sterol composition

  • Alternative membrane targets:

    • Shifting focus from sterols to other essential membrane components

    • Developing compounds that specifically disrupt membranes containing incorporated cholesterol

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.