Recombinant Candida glabrata Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC62; CAGL0H05731g; Translocation protein SEC62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
Target Protein Sequence
MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLKSDAYKKKSLKQPDLYP PLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGLKPSKDYPHLIMSTKATLD DNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASMRRGTYYLSLAAFGFLGVFFG VAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSFKPLYGFGDKETYTYIKKMKKQK KRQAKKEKLKKLKEKAN
Uniprot No.

Target Background

Function

Required for preprotein translocation.

Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of SEC62 in Candida glabrata protein translocation?

SEC62 in C. glabrata functions as an essential component of the heptameric SEC complex (comprising Sec61, Sbh1, Sss1, Sec62, Sec63, Sec71, and Sec72) that facilitates post-translational translocation of proteins across the endoplasmic reticulum membrane . Unlike co-translational translocation which relies on Signal Recognition Particle (SRP), the SEC62-dependent pathway recognizes and binds to signal peptides of nascent proteins after their synthesis is complete. In this process, Sec62 works cooperatively with Sec61 and Sec72 to simultaneously bind the signal sequence of proteins destined for post-translational import . Methodologically, this function can be analyzed through in vitro translocation assays using purified components and radiolabeled substrate proteins, or through genetic complementation studies in temperature-sensitive yeast mutants.

How does C. glabrata SEC62 structurally differ from homologs in other Candida species?

While specific structural comparisons of SEC62 across Candida species are not explicitly detailed in the provided search results, we can infer some differences based on evolutionary patterns. C. glabrata, like Saccharomyces cerevisiae, underwent whole-genome duplication (WGD), which sets it apart from many other Candida species . This genomic event likely influenced the evolution of protein translocation components.

The structural investigation of SEC62 typically involves:

  • Sequence alignment analysis across species using tools like Clustal Omega

  • Domain prediction using InterPro or SMART databases

  • Hydrophobicity analysis to predict transmembrane regions

  • Crystallographic studies (when possible) or structural modeling based on homologous proteins

A comprehensive comparative analysis would require examining conserved domains, transmembrane regions, and interaction sites that facilitate binding with other components of the translocation machinery.

What expression systems are most effective for producing recombinant C. glabrata SEC62?

For recombinant expression of C. glabrata SEC62, researchers should consider several systems based on experimental goals:

Expression SystemAdvantagesChallengesBest Applications
E. coliHigh yield, cost-effective, rapid expressionMay lack proper folding/PTMs for membrane proteinsInitial structural studies, antibody production
S. cerevisiaeNatural yeast environment, proper folding, functional complementation possibleLower yield than bacterial systemsFunctional studies, protein-protein interactions
P. pastorisHigh density cultivation, strong inducible promotersLonger development timeLarge-scale production, glycosylated variants
Mammalian cellsAdvanced post-translational modificationsExpensive, lower yieldsStudies requiring mammalian-type modifications

For membrane proteins like SEC62, yeast expression systems often provide advantages in proper folding and membrane insertion. When using S. cerevisiae, employing temperature-sensitive sec62 mutant strains for complementation assays can simultaneously validate the functionality of the recombinant protein.

How can researchers assess the interaction between C. glabrata SEC62 and other components of the translocation machinery?

Investigating protein-protein interactions within the translocation complex requires sophisticated biochemical and biophysical approaches:

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged versions of SEC62 to pull down associated proteins. This approach benefits from crosslinking prior to cell lysis when studying membrane protein complexes.

  • Split-ubiquitin yeast two-hybrid assay: Particularly suitable for membrane proteins like SEC62, this modified Y2H system can detect interactions at the ER membrane.

  • Förster Resonance Energy Transfer (FRET): By tagging SEC62 and potential interaction partners with appropriate fluorophores, researchers can detect proximity-based energy transfer in living cells.

  • In vitro binding assays: Using purified components to assess direct interactions. For example:

    • SEC62 can be shown to interact with the transmembrane domain of SEC63

    • The cytosolic domains of SEC62 likely interact with signal sequences and possibly with ribosomal components

  • Molecular dynamics simulations: Computational approaches can model potential interaction interfaces between SEC62 and other translocon components based on predicted structures .

These methods should be employed as complementary approaches, as each has specific limitations when studying membrane protein complexes.

What role does C. glabrata SEC62 play in pathogenesis and host-pathogen interactions?

While SEC62 is primarily known for its role in protein translocation, emerging research suggests connections to pathogenesis through its essential function in secretory pathway regulation:

C. glabrata secretes various proteins that can influence host-pathogen interactions and interspecies communication. For example, the search results indicate that C. glabrata secretes a unique small protein Yhi1 that induces hyphal growth in C. albicans, essential for host tissue invasion . This form of communication appears specific to C. glabrata and C. albicans interaction . As a component of the protein secretion machinery, SEC62 likely plays an indirect but essential role in the export of such virulence factors.

The potential involvement of SEC62 in pathogenesis can be investigated through:

  • Conditional mutant studies: Using temperature-sensitive or tetracycline-regulated SEC62 mutants to examine effects on secretion of virulence factors

  • Secretome analysis: Comparing the secreted protein profile of wild-type versus SEC62-depleted strains using proteomics

  • Co-infection models: Examining how SEC62 disruption affects C. glabrata's ability to establish mixed-species infections with C. albicans

  • Transcriptional profiling: Determining whether SEC62 expression changes under infection-relevant conditions (pH changes, oxidative stress, etc.)

The essential nature of SEC62 makes direct knockout studies challenging, necessitating conditional approaches for functional analysis in pathogenesis.

How does post-translational regulation affect C. glabrata SEC62 function during stress conditions?

SEC62 function may be regulated in response to cellular stresses that affect protein folding and secretion:

Under stress conditions such as nutrient limitation or antifungal exposure, C. glabrata likely modulates its secretory pathway to adapt. Though specific data on SEC62 regulation is limited in the search results, research strategies to investigate this question include:

  • Phosphoproteomics: Identifying potential phosphorylation sites on SEC62 that change under stress conditions

  • Protein abundance analysis: Measuring SEC62 levels during different growth phases and stress conditions using quantitative proteomics or western blotting

  • Localization studies: Examining whether SEC62 changes subcellular distribution under stress using fluorescently-tagged constructs

  • Interactome analysis: Determining whether SEC62 associations with other proteins change during stress responses

  • Unfolded Protein Response (UPR) connection: Investigating the relationship between SEC62 function and UPR activation, which occurs during ER stress

These approaches would provide insights into how C. glabrata might regulate protein translocation during stress adaptation and pathogenesis.

What are the critical controls needed when analyzing recombinant C. glabrata SEC62 function in heterologous systems?

When studying C. glabrata SEC62 in heterologous systems (e.g., S. cerevisiae, E. coli), researchers should implement several critical controls:

Control TypePurposeImplementation
Functionality validationConfirm the recombinant protein is functionalComplementation assay in SEC62 temperature-sensitive yeast mutants
Expression verificationEnsure proper expression levelsWestern blot with epitope tag antibodies or SEC62-specific antibodies
Localization controlVerify correct subcellular targetingImmunofluorescence or fractionation to confirm ER membrane localization
Species-specificityDetermine if function is conservedCompare with S. cerevisiae SEC62 in parallel experiments
Negative controlEstablish baselineEmpty vector or non-functional SEC62 mutant (e.g., transmembrane domain deletion)
Positive controlBenchmark for full activityWild-type SEC62 from the same species as the heterologous system

The search results suggest that complementation across species can be challenging - for example, S. pombe and C. albicans Sec61 failed to complement the respective mutant in S. cerevisiae due to amino acid substitutions in cytoplasmic loops . Similar species-specific differences might exist for SEC62, making proper controls essential.

How can researchers overcome challenges in studying an essential gene like SEC62 in C. glabrata?

As SEC62 is essential for viability in yeast , studying its function presents methodological challenges that can be addressed through:

Each approach has advantages and limitations, and researchers should select methods based on specific experimental questions about SEC62 function.

How do functional differences between C. glabrata and C. albicans SEC62 contribute to their distinct pathogenicity profiles?

C. glabrata and C. albicans exhibit different pathogenicity mechanisms, with C. glabrata showing increased antifungal resistance while C. albicans relies more on hyphal morphogenesis for virulence . Though the search results don't directly address SEC62 differences between these species, we can analyze potential contributions:

C. glabrata, like S. cerevisiae, underwent whole-genome duplication (WGD) , potentially allowing for functional diversification of secretory pathway components compared to C. albicans. This genomic difference might influence how SEC62 functions in each species' protein secretion machinery, potentially affecting:

  • Virulence factor secretion: The efficiency of SEC62-dependent translocation could affect the export of species-specific virulence factors

  • Stress adaptation: Differences in SEC62 function might contribute to C. glabrata's enhanced stress resistance

  • Interspecies communication: The search results indicate C. glabrata secretes Yhi1 that induces C. albicans hyphal growth , suggesting specialized secretory functions that might involve SEC62

Research approaches to investigate these differences include:

  • Complementation studies to determine if C. albicans SEC62 can function in C. glabrata and vice versa

  • Chimeric protein construction to identify domains responsible for species-specific functions

  • Comparative protein interaction studies to map differences in translocon complex assembly

  • Transcriptional regulation analysis of SEC62 under infection-relevant conditions in both species

What methodological considerations are important when comparing recombinant SEC62 from different Candida species?

When conducting comparative studies of SEC62 across Candida species, researchers should consider several methodological factors:

  • Codon optimization: Different Candida species have distinct codon usage biases. For example:

    • C. glabrata uses a standard genetic code like S. cerevisiae

    • C. albicans has a non-standard genetic code where CTG encodes serine instead of leucine

    This necessitates appropriate codon optimization for heterologous expression.

  • Expression system selection:

    • For direct comparison, all SEC62 variants should be expressed in the same system

    • S. cerevisiae often provides the best comparative platform due to similar membrane composition

  • Protein tagging strategy:

    • Tag position (N- vs C-terminal) may differently affect each species' SEC62

    • Standardized tag placement is crucial for valid comparisons

  • Functional assay standardization:

    • Growth complementation assays should use identical conditions

    • In vitro translocation assays should employ the same substrate proteins

    • Interaction studies should use consistent detection methods

  • Sequence-structure-function correlation:

    • Comprehensive sequence alignment of SEC62 from multiple species

    • Identification of conserved vs. variable regions

    • Targeted mutagenesis of species-specific residues to determine functional significance

A standardized comparative framework enhances the validity of cross-species functional differences observed in SEC62 proteins.

How can structural biology approaches be applied to study C. glabrata SEC62 interactions within the translocon complex?

Structural biology offers powerful tools to elucidate SEC62's interactions within the translocon complex:

  • Cryo-electron microscopy (Cryo-EM):

    • Most suitable for capturing the intact translocon complex

    • Can visualize SEC62 in its native membrane environment

    • May reveal conformational changes during translocation

  • X-ray crystallography:

    • Challenging for full transmembrane proteins but feasible for soluble domains

    • Can provide high-resolution structures of SEC62's cytoplasmic domains

    • Co-crystallization with interacting peptides can map binding interfaces

  • NMR spectroscopy:

    • Applicable to study dynamics of smaller SEC62 domains

    • Can detect weak or transient interactions with signal peptides

    • Useful for examining conformational changes upon binding

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies interaction interfaces between SEC62 and other translocon components

    • Can capture dynamic interactions during different translocation stages

    • Particularly valuable when combined with structural modeling

  • Integrative structural biology:

    • Combining multiple techniques (Cryo-EM, XL-MS, computational modeling)

    • Can build comprehensive models of the SEC complex architecture

    • The search results suggest molecular dynamics simulation is applicable, as demonstrated for the interaction between CgMfa2 and CgYhi1 proteins

These approaches could clarify how SEC62 contributes to substrate recognition and channel gating during post-translational protein import.

What potential exists for targeting C. glabrata SEC62 in antifungal drug development?

As an essential component of the protein translocation machinery , SEC62 represents a potential target for novel antifungal strategies:

  • Target validation approaches:

    • Conditional depletion of SEC62 to confirm growth inhibition and phenotypic effects

    • Chemical-genetic profiling to identify synthetic interactions that enhance SEC62 inhibition

    • Heterozygous strain analysis to determine if partial inhibition is sufficient for growth defects

  • Drug discovery strategies:

    • High-throughput screening using SEC62 functional assays

    • Fragment-based drug discovery targeting specific SEC62 domains

    • Structure-based design if structural data becomes available

    • Peptide mimetics that interfere with SEC62-signal sequence interactions

  • Therapeutic window considerations:

    • Comparative analysis of fungal vs. human SEC62 to identify exploitable differences

    • Assessment of selectivity between pathogenic and commensal fungi

    • Evaluation of resistance development potential

  • Combination therapy potential:

    • Synergy testing with existing antifungals

    • Evaluation as a sensitizing target that enhances conventional treatment

The rising antifungal resistance in C. glabrata makes novel targets like SEC62 particularly valuable for future therapeutic development.

What are common pitfalls in analyzing C. glabrata SEC62 function and how can researchers address them?

Researchers investigating C. glabrata SEC62 may encounter several methodological challenges:

ChallengePotential CausesSolutions
Poor recombinant expressionMembrane protein toxicity, codon biasUse inducible promoters, optimize codons, express toxic domains separately
Aberrant localization in heterologous systemsDifferences in targeting machineryInclude C. glabrata-specific targeting sequences, verify localization microscopically
Lack of functional complementationSpecies-specific interactionsCreate chimeric constructs with host-specific interaction domains
Difficulty in detecting protein-protein interactionsTransient associations, hydrophobic interactionsUse membrane-specific interaction assays (split-ubiquitin), crosslinking approaches
Challenges in purificationMultiple transmembrane domainsUse mild detergents, nanodiscs, or styrene maleic acid lipid particles (SMALPs)
Inconsistent in vitro translocation resultsVariable microsome qualityStandardize microsome preparation, include positive controls in each assay

The search results highlight cross-species complementation challenges with translocon components , indicating that researchers should carefully consider species-specific factors when designing SEC62 experiments.

How can researchers differentiate between direct and indirect effects when manipulating SEC62 expression in C. glabrata?

As SEC62 affects global protein translocation, distinguishing direct from indirect effects requires careful experimental design:

  • Temporal analysis:

    • Examining early versus late effects after SEC62 depletion

    • Immediate consequences are more likely direct effects

    • Time-course experiments to establish causality chains

  • Substrate specificity profiling:

    • Identifying which secretory proteins are most rapidly affected

    • Comparing effects on proteins known to use post- versus co-translational pathways

    • Using reporter constructs with varying signal sequences

  • Separation of function mutations:

    • Creating SEC62 variants that disrupt specific interactions but maintain others

    • Allows attribution of phenotypes to specific SEC62 functions

  • Rescue experiments:

    • Complementing SEC62 depletion with downstream pathway activations

    • If a phenotype can be rescued without restoring SEC62, it suggests an indirect effect

  • Biochemical reconstitution:

    • In vitro translocation assays with purified components

    • Allows direct assessment of SEC62's role in protein import independent of cellular context

These approaches help delineate SEC62's direct functions from secondary effects resulting from broad secretory pathway disruption.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.