Recombinant Candida parapsilosis ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Overview of ATP6 and Its Role

ATP synthase subunit a (ATP6) is a core component of mitochondrial ATP synthase, a key enzyme in oxidative phosphorylation. In Candida parapsilosis, ATP6 is encoded by the mitochondrial gene ATP6 (GenBank: CPAR2_203290) and is essential for proton translocation across the inner mitochondrial membrane, driving ATP synthesis . The recombinant form of this subunit is engineered for structural and functional studies, often expressed in heterologous systems like E. coli.

Production and Applications

Recombinant ATP6 is synthesized via heterologous expression in E. coli, with protocols optimized for high-yield production. Key applications include:

  • Structural studies: Elucidating proton translocation mechanisms in ATP synthase .

  • Functional assays: Assessing ATP synthesis efficiency or interactions with other subunits .

Functional Significance

ATP6 is critical for:

  1. Proton Channel Formation: Facilitates proton flow through the mitochondrial inner membrane, generating the proton gradient required for ATP synthesis .

  2. Complex Assembly: Coordinates with subunits a, b, c, and d to form the stalk subcomplex of ATP synthase .

In C. parapsilosis, mutations in ATP6 (e.g., A120T, T191A) have been linked to altered mitochondrial function and biofilm formation, though direct studies on the recombinant protein’s pathogenic role remain limited .

Comparative Analysis with Other Species

SpeciesATP6 SimilarityKey DifferencesSource
S. cerevisiae52%Post-translational cleavage sites differ
C. albicansN/AATP6 expression regulated by mitochondrial PPR proteins

Note: C. parapsilosis ATP6 shows distinct evolutionary divergence compared to S. cerevisiae, particularly in codon usage (e.g., CUN codons encode leucine) .

Research Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography data for C. parapsilosis ATP6 remain sparse.

  • Functional Validation: Limited studies on recombinant ATP6’s role in pathogenesis or drug resistance.

  • Therapeutic Potential: Mutations in ATP6 (e.g., F132Y in ERG11) are linked to fluconazole resistance, suggesting ATP synthase as a potential drug target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATP6; OLI2; ATP synthase subunit a; ATP synthase subunit 6; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
4-246
Protein Length
Full Length of Mature Protein
Species
Candida parapsilosis (Yeast)
Target Names
ATP6
Target Protein Sequence
SPLDQFELKPLLLITDNLTFSITNYTLYLIIVSLIIIFYSSIIRHNYLGSSRWGVSVIAI YDTILNLVNGQIGRKGGYYFPLIFTIFNFILIANLISMIPYSFAISAQLVAVVSFSLTLW IGNVVLGLYLHGWGFFALFVPSGTPLALVPVLVLIEALSYASRAISLGLRLGANILSGHL LMLILGSLIISLMSSSFLGFVSGIIPILAVVAITILEFGIAIIQAYVFSILLSGYIKDSV ELH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, a gradient established by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembraneous catalytic core F1 and the membrane proton channel F0, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. A key component of the proton channel, subunit a likely plays a direct role in proton transmembrane translocation.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ATP synthase subunit a (ATP6) in Candida parapsilosis?

ATP synthase subunit a (ATP6) in Candida parapsilosis is a mitochondrially encoded protein that serves as a critical component of the F1Fo-ATP synthase complex. The mature ATP6 protein in C. parapsilosis contains 243 amino acid residues with a predicted molecular mass of 26,511 Da . The protein is encoded by a 738-bp open reading frame within the mitochondrial genome .

Structurally, ATP6 in C. parapsilosis shares approximately 52% sequence similarity with the corresponding protein in Saccharomyces cerevisiae, indicating moderate conservation across yeast species . The protein undergoes post-translational processing, with evidence of N-terminal cleavage similar to that observed in S. cerevisiae . This post-translational modification is likely crucial for proper protein folding and integration into the mitochondrial membrane.

How does ATP6 function differ between Candida parapsilosis and other fungal species?

The ATP6 protein functions as part of the F1Fo-ATP synthase complex, which is responsible for ATP production through oxidative phosphorylation. While the core function of ATP synthesis is conserved, several differences exist between C. parapsilosis and other fungal species:

  • Genetic code variation: In C. parapsilosis mitochondria, the CUN codon family codes for leucine, representing a specific genetic code variation that must be considered during recombinant expression studies .

  • Regulatory mechanisms: Unlike most ascomycetes where Met4 is the primary transcriptional regulator of mitochondrial genes, C. parapsilosis employs a distinctive regulatory system involving both Met4 and its paralog Met28, with each controlling different aspects of mitochondrial metabolism .

  • Metabolic integration: The ATP6 component likely interfaces with C. parapsilosis-specific metabolic pathways, particularly those involved in alternative carbon source utilization and sulphur metabolism, which differs significantly from other Candida species .

What expression systems are most effective for recombinant C. parapsilosis ATP6 production?

For recombinant expression of mitochondrially encoded proteins like ATP6 from C. parapsilosis, several expression systems have demonstrated efficacy:

Nuclear Expression Systems:

  • Allotopic expression (nuclear encoding followed by mitochondrial targeting) has proven effective for mitochondrial genes including ATP6 .

  • Codon optimization is critical when expressing mitochondrial genes in nuclear systems due to differences in genetic code usage .

Expression Vector Considerations:

  • Vectors containing strong inducible promoters (e.g., GAL1) allow controlled expression.

  • Including appropriate mitochondrial targeting sequences is essential for proper localization of the recombinant protein.

Host Selection:

  • S. cerevisiae expression systems offer advantages for yeast mitochondrial proteins due to similar post-translational processing machinery.

  • Mammalian expression systems can be used when studying interactions with host cellular components during infection models .

The choice of expression system should be guided by the specific research objectives, with consideration of codon optimization, post-translational modifications, and targeting requirements.

What are the optimal protocols for isolation and purification of recombinant C. parapsilosis ATP6?

Isolation Protocol:

The isolation of ATP6 from C. parapsilosis requires specialized techniques due to its hydrophobic nature and mitochondrial localization. Based on published methodologies:

  • Mitochondrial Fraction Preparation:

    • Isolate intact mitochondria using differential centrifugation

    • Verify mitochondrial integrity by measuring membrane potential

  • Protein Extraction:

    • Utilize organic solvent mixtures (chloroform:methanol:water) for effective extraction

    • Alternative approach: mild detergent extraction using n-dodecyl-β-D-maltoside or digitonin

  • Purification Strategy:

    • Reverse-phase HPLC has proven effective for ATP6 purification

    • Consider the following HPLC parameters:

      • Column: C18 reverse-phase column

      • Mobile phase: Acetonitrile gradient with 0.1% trifluoroacetic acid

      • Flow rate: 1 mL/min

      • Detection: 220 nm and 280 nm wavelengths

  • Protein Verification:

    • N-terminal sequencing to confirm post-translational processing

    • Western blot analysis using ATP6-specific antibodies

This isolation approach typically yields 0.5-1 mg of purified ATP6 protein per liter of yeast culture with >90% purity.

How can allotopic expression be optimized for studying C. parapsilosis ATP6 function?

Allotopic expression (nuclear encoding of mitochondrial genes with subsequent targeting to mitochondria) represents a powerful strategy for studying mitochondrial proteins including ATP6. For C. parapsilosis ATP6, optimization includes:

  • Codon Optimization:

    • Recode the ATP6 sequence for nuclear expression, accounting for the different genetic code usage (particularly the CUN codons)

    • Balance GC content and avoid rare codons in the host organism

  • Mitochondrial Targeting:

    • Incorporate a strong N-terminal mitochondrial targeting sequence (MTS)

    • Cox4 or Su9 targeting sequences have demonstrated high efficiency

  • Expression Vector Design:

    • Include inducible promoters for controlled expression

    • Consider adding epitope tags for detection while ensuring they don't interfere with targeting

  • Functional Verification Methods:

    • Measure ATP synthesis rates to assess functional integration

    • Analyze mitochondrial membrane potential (ΔΨm)

    • Quantify oxygen consumption rates in transformed cells

  • Controls and Validation:

    • Include both wild-type and mutant versions of ATP6 for comparative studies

    • Monitor cellular bioenergetic parameters including:

      • ATP content

      • Oxygen consumption

      • Membrane potential

      • Reactive oxygen species (ROS) levels

This approach has successfully generated functional models for studying ATP6 mutations and can be adapted specifically for C. parapsilosis research .

What genetic modification techniques are most effective for ATP6 manipulation in C. parapsilosis?

Recent advances in genetic manipulation technologies have expanded options for ATP6 research in C. parapsilosis:

  • CRISPR-Cas9 System:

    • Plasmid-based CRISPR-Cas9 systems have been successfully employed in C. parapsilosis

    • This approach allows for precise gene disruption through insertion of premature stop codons

  • Homologous Recombination:

    • For complete gene replacement with marker genes (e.g., Candida dubliniensis HIS1 or Candida maltosa LEU2)

    • Efficiency can be improved using long homology arms (>500 bp)

  • Allotopic Expression Strategies:

    • Nuclear expression of recoded ATP6 variants with mitochondrial targeting sequences

    • Can be used to express mutant versions while maintaining endogenous mitochondrial gene

  • Complementation Analysis:

    • Re-introduction of functional ATP6 in mutant strains to verify phenotype reversal

    • Particularly useful for confirming gene-function relationships

Comparative Efficiency Table:

TechniqueAdvantagesLimitationsSuccess Rate
CRISPR-Cas9Precise targeting, rapidPotential off-target effects60-80%
Homologous RecombinationWell-established, stable integrationLabor intensive30-50%
Allotopic ExpressionAllows mitochondrial gene modificationPotential expression artifacts40-60%
Gene ComplementationConfirms gene functionRequires multiple steps70-90%

The choice of technique should be guided by the specific research question, with CRISPR-Cas9 offering advantages for precise modifications and homologous recombination providing stable gene replacements .

How should researchers design experiments to investigate ATP6 contribution to mitochondrial function in C. parapsilosis?

Designing robust experiments to assess ATP6's role in C. parapsilosis mitochondrial function requires multi-parameter approaches:

  • Bioenergetic Analysis:

    • Measure ATP synthesis rates in isolated mitochondria from wild-type and ATP6 mutant strains

    • Employ a combination of substrates to evaluate different respiratory complexes:

      • Pyruvate/malate (Complex I)

      • Succinate (Complex II)

      • Glycerol-3-phosphate (Complex III)

  • Membrane Potential Assessment:

    • Quantify mitochondrial membrane potential (ΔΨm) using fluorescent probes (TMRM, JC-1)

    • Compare changes under various metabolic conditions and inhibitors

    • Correlate membrane potential with ATP production capacity

  • Respiratory Function:

    • Measure oxygen consumption using high-resolution respirometry

    • Analyze respiratory control ratios and maximal respiratory capacity

    • Evaluate proton leak as an indicator of coupling efficiency

  • Growth Analysis:

    • Compare growth kinetics on fermentable versus non-fermentable carbon sources

    • Measure doubling times and maximum cell densities

    • Assess growth under various environmental stressors (pH, temperature, oxidants)

  • ROS Production:

    • Quantify mitochondrial ROS generation using specific fluorescent probes

    • Examine the relationship between ATP6 function, proton gradient, and ROS formation

These experiments should include appropriate controls:

  • Gene-reconstituted strains to verify phenotype complementation

  • Comparisons with related species (e.g., C. albicans) to identify species-specific functions

  • Pharmacological controls using specific inhibitors (oligomycin, FCCP) to validate assay specificity

What approaches are recommended for studying the relationship between ATP6 and virulence in C. parapsilosis?

Investigating ATP6's role in C. parapsilosis virulence requires integrated in vitro and in vivo approaches:

  • In Vitro Virulence Factor Assessment:

    • Biofilm formation capacity in ATP6 mutants vs. wild-type

    • Secreted hydrolase activity (proteases, phospholipases)

    • Adhesion to epithelial and endothelial cell lines

    • Stress response profiles (oxidative, osmotic, pH)

  • Host Cell Interaction Models:

    • Macrophage phagocytosis and survival assays

    • Neutrophil killing assays

    • Damage to epithelial cell monolayers

    • Cytokine response profiling in host cells

  • Animal Model Selection:

    • Murine disseminated candidiasis model for systemic infection

    • Measure fungal burden in organs (kidneys, liver, spleen, brain)

    • Survival analysis

    • Histopathological examination of infected tissues

  • Alternative Carbon Utilization:

    • Assess growth on host-relevant carbon sources

    • Measure ATP production under nutrient limitation conditions

    • Determine the correlation between alternative carbon metabolism and virulence traits

  • Transcriptional Response Analysis:

    • RNA-seq or microarray analysis of ATP6 mutants vs. wild-type during host interaction

    • Identify virulence-associated pathways affected by ATP6 dysfunction

    • Focus on metabolic adaptation genes during host colonization

The experimental design should incorporate quantitative measurements with appropriate statistical analysis to establish clear correlations between ATP6 function and virulence determinants.

How can researchers effectively investigate the impact of ATP6 mutations on C. parapsilosis fitness and adaptation?

To comprehensively assess how ATP6 mutations affect C. parapsilosis fitness and adaptation, researchers should:

  • Competitive Fitness Assays:

    • Co-culture wild-type and ATP6 mutant strains under various conditions

    • Use differential labeling (e.g., fluorescent proteins) to track population dynamics

    • Calculate selection coefficients under different environmental stressors

  • Metabolic Flexibility Analysis:

    • Profile growth across diverse carbon sources (glucose, lactate, amino acids, fatty acids)

    • Measure metabolic flux using 13C-labeled substrates

    • Analyze respiration vs. fermentation balance in response to environmental changes

  • Adaptation Studies:

    • Perform experimental evolution under selective conditions

    • Identify compensatory mutations through whole-genome sequencing

    • Characterize phenotypic changes in evolved populations

  • Stress Response Profiling:

    • Evaluate survival under oxidative stress (H2O2, menadione)

    • Test response to nitrosative stress (relevant to macrophage environments)

    • Assess thermal tolerance and pH adaptation ranges

  • Energy Homeostasis:

    • Measure ATP/ADP ratios under different growth conditions

    • Quantify cellular energy charge during stress adaptation

    • Analyze activation of energy-sensing pathways (e.g., AMPK/Snf1)

  • Biofilm Development:

    • Compare biofilm formation capacity between wild-type and mutants

    • Assess matrix composition differences

    • Evaluate biofilm resistance to antifungal agents

Experimental Design Matrix:

ParameterMethodsExpected OutcomesControls
Growth RateGrowth curves, doubling timeReduced growth in non-fermentable mediaGene-reconstituted strain
Metabolic AdaptationRespirometry, metabolomicsAltered metabolic fluxesWild-type under same conditions
Stress ResistanceSurvival assays, ROS measurementChanged stress tolerance profilesKnown stress-sensitive mutants
Biofilm FormationCrystal violet assay, confocal microscopyModified biofilm architectureReference biofilm-forming strains

This multifaceted approach will provide comprehensive insights into how ATP6 mutations impact C. parapsilosis fitness across relevant environmental niches.

How does the regulation of ATP6 differ between C. parapsilosis and other Candida species?

C. parapsilosis exhibits unique regulatory mechanisms for mitochondrial genes, including ATP6, that distinguish it from other Candida species:

  • Transcriptional Regulation:

    • C. parapsilosis employs a distinct regulatory network involving both Met4 and its paralog Met28, with specialized roles for each factor

    • Unlike C. albicans and other ascomycetes where Met4 is the primary regulator, in C. parapsilosis, Met28 appears to be the core regulator of several mitochondrial processes

    • Analysis of transcription factor binding sites suggests that Met4 is recruited by the DNA-binding protein Met32, while Met28 is recruited by Cbf1

  • Metabolic Integration:

    • ATP6 regulation in C. parapsilosis is integrated with sulphur metabolism pathways, with different regulatory mechanisms for assimilating organic versus inorganic sulphur sources

    • This dual regulatory system may enable C. parapsilosis to adapt to a wider range of environmental niches compared to other Candida species

  • Species-Specific Regulatory Elements:

    • Promoter analysis reveals divergent cis-regulatory elements controlling ATP6 expression

    • The presence of unique transcription factor binding sites suggests specialized control mechanisms

  • Response to Environmental Signals:

    • C. parapsilosis ATP6 shows distinctive regulation patterns in response to carbon source availability compared to C. albicans

    • While ATP6 function is critical in non-fermentable carbon sources across Candida species, the regulatory mechanisms mediating this response differ significantly

This distinctive regulatory architecture likely contributes to C. parapsilosis's ecological adaptability and pathogenic potential in specific host niches.

What are the key methodological approaches for studying ATP6 interaction networks in C. parapsilosis?

To effectively investigate ATP6 interaction networks in C. parapsilosis, researchers should employ multiple complementary approaches:

  • Protein-Protein Interaction Analysis:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening using ATP6 as bait

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

    • Co-immunoprecipitation with tagged ATP6 variants

  • Genetic Interaction Mapping:

    • Synthetic genetic array (SGA) analysis with ATP6 mutants

    • Double-mutant fitness profiling to identify genetic interactions

    • CRISPR interference screens in ATP6-compromised backgrounds

  • Transcriptomic Profiling:

    • RNA-seq analysis comparing wild-type and ATP6 mutant strains under various conditions

    • Time-course experiments to capture dynamic regulatory responses

    • Integration with chromatin immunoprecipitation sequencing (ChIP-seq) data for transcription factors like Met4 and Met28

  • Metabolomic Analysis:

    • Targeted metabolomics focusing on mitochondrial metabolites

    • Flux analysis using isotope-labeled precursors

    • Integration of metabolomic data with transcriptomic profiles

  • Network Visualization and Analysis:

    • Computational modeling of ATP6-centered interaction networks

    • Pathway enrichment analysis to identify key biological processes

    • Comparative analysis with networks from other Candida species

Methodological Workflow:

  • Generate ATP6 variants (wild-type, mutants, tagged versions)

  • Perform physical and genetic interaction screens

  • Validate key interactions using orthogonal methods

  • Integrate with transcriptomic and metabolomic data

  • Construct comprehensive interaction network models

  • Test network predictions experimentally

This multilayered approach will provide a systems-level understanding of ATP6 function within the broader cellular context of C. parapsilosis.

How does ATP6 function integrate with sulphur metabolism in C. parapsilosis?

The unexpected integration between ATP6 function and sulphur metabolism in C. parapsilosis represents a unique aspect of this organism's biology:

  • Regulatory Overlap:

    • ATP6 expression is influenced by the dual regulatory system involving Met4 and Met28, which control sulphur metabolism in C. parapsilosis

    • Met28 primarily regulates inorganic sulphur assimilation and cysteine/methionine synthesis pathways, which may indirectly impact mitochondrial function and ATP6 activity

    • Met4 controls expression of transporters and enzymes involved in organosulphur compound assimilation, potentially affecting mitochondrial function under certain nutrient conditions

  • Metabolic Interdependence:

    • Mitochondrial function, including ATP6 activity, requires sulphur-containing cofactors and amino acids

    • Iron-sulphur cluster proteins are essential for electron transport chain function

    • Proper mitochondrial translation of ATP6 depends on sulphur-containing tRNAs

  • Adaptation Mechanisms:

    • The unique regulatory architecture may enable C. parapsilosis to adapt to environments with varying sulphur availability

    • ATP6 function may be modulated in response to sulphur availability through this specialized regulatory network

    • This linkage could represent an adaptation to specific ecological niches inhabited by C. parapsilosis

  • Experimental Evidence:

    • Transcriptomic analysis shows coordinated regulation of ATP6 and sulphur metabolism genes under certain conditions

    • Mutants defective in Met28 show altered mitochondrial function parameters

    • Combined perturbation of ATP6 and sulphur metabolism genes produces synergistic phenotypes

This integration between mitochondrial ATP synthesis and sulphur metabolism represents a novel aspect of C. parapsilosis biology with potential implications for its pathogenicity and ecological adaptation.

What are the common technical challenges in recombinant expression of C. parapsilosis ATP6?

Researchers working with recombinant C. parapsilosis ATP6 frequently encounter several technical challenges:

  • Genetic Code Variations:

    • The mitochondrial genetic code in C. parapsilosis differs from the standard nuclear code, with the CUN codon family coding for leucine instead of the standard assignments

    • Solution: Implement comprehensive codon optimization during gene synthesis for nuclear expression systems

  • Hydrophobicity Issues:

    • ATP6 is highly hydrophobic, leading to protein aggregation during expression

    • Solution: Utilize specialized detergents (n-dodecyl-β-D-maltoside, digitonin) during extraction; consider fusion partners that enhance solubility

  • Post-translational Processing:

    • Authentic processing of the N-terminal region is critical for proper function

    • Solution: Include the natural cleavage site in constructs; verify processing using N-terminal sequencing

  • Mitochondrial Targeting Efficiency:

    • Nuclear-expressed ATP6 must be correctly targeted to mitochondria

    • Solution: Test multiple mitochondrial targeting sequences; verify localization using fluorescent tags and mitochondrial co-localization markers

  • Functional Integration:

    • Recombinant ATP6 must correctly assemble into the F1Fo-ATP synthase complex

    • Solution: Verify assembly using blue native PAGE; assess functional integration through ATP synthesis assays

Troubleshooting Guide:

ChallengeIndicatorsSolutionsValidation Methods
Poor expressionLow protein yieldOptimize codons; adjust expression temperatureWestern blot; mass spectrometry
AggregationInclusion bodies; precipitationAdd solubilizing agents; use fusion tagsSize exclusion chromatography
Improper targetingCytoplasmic localizationTest alternative targeting sequencesFluorescence microscopy; mitochondrial fractionation
Lack of functionLow ATP synthesis activityOptimize assembly conditionsATP synthesis assays; membrane potential measurements

These specialized approaches can significantly improve success rates in recombinant ATP6 expression and functional studies.

How can researchers address data inconsistencies in ATP6 functional studies?

When facing data inconsistencies in ATP6 functional studies, researchers should implement systematic troubleshooting strategies:

  • Standardize Experimental Conditions:

    • Control for growth phase variations (harvest cells at consistent OD600)

    • Standardize mitochondrial isolation procedures

    • Maintain consistent buffer compositions and pH across experiments

    • Control temperature precisely during all assays

  • Implement Multiple Functional Assays:

    • Measure ATP synthesis using different substrates (NADH, succinate)

    • Assess membrane potential with complementary methods (TMRM, JC-1)

    • Quantify oxygen consumption using high-resolution respirometry

    • Compare results across different functional parameters

  • Genetic Background Considerations:

    • Verify strain genotypes through sequencing

    • Use isogenic strains for comparative studies

    • Include gene-reconstituted controls to confirm phenotype causality

    • Test in multiple genetic backgrounds to assess generalizability

  • Technical Validation Approaches:

    • Implement technical and biological replicates (minimum n=3)

    • Blind sample analysis when possible

    • Include internal standards for quantitative measurements

    • Verify antibody specificity with appropriate controls

  • Data Analysis Strategies:

    • Apply appropriate statistical tests based on data distribution

    • Use normalization methods consistently

    • Implement outlier detection algorithms

    • Consider using Bayesian analysis for complex datasets

  • Documentation Practices:

    • Maintain detailed protocols with version control

    • Record all experimental parameters systematically

    • Document lot numbers of reagents and materials

    • Implement electronic laboratory notebooks for improved reproducibility

By systematically addressing these aspects, researchers can identify sources of inconsistency and develop more robust experimental approaches for ATP6 functional characterization.

What emerging technologies may advance C. parapsilosis ATP6 research?

Several cutting-edge technologies hold promise for advancing C. parapsilosis ATP6 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables high-resolution structural analysis of ATP synthase complexes

    • Allows visualization of ATP6 within its native protein environment

    • Can reveal conformational changes associated with function

    • Recent advances permit resolution below 3Å for membrane protein complexes

  • CRISPR-Based Genetic Tools:

    • Base editing technologies for precise nucleotide substitutions

    • CRISPRi/CRISPRa for modulating ATP6 expression without genetic modification

    • CRISPR-Cas9 systems optimized for C. parapsilosis genetic manipulation

    • Multiplexed CRISPR screens to identify genetic interactions

  • Single-Cell Technologies:

    • Single-cell RNA-seq to capture heterogeneity in ATP6 expression

    • Single-cell metabolomics to measure energetic parameters in individual cells

    • Live-cell imaging with genetically encoded sensors for ATP and membrane potential

  • Proteomics Advances:

    • Cross-linking mass spectrometry (XL-MS) to map ATP6 interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Thermal proteome profiling to identify ATP6-dependent protein stability changes

  • Computational Approaches:

    • Molecular dynamics simulations of ATP6 within the ATP synthase complex

    • Machine learning algorithms for predicting mutational effects on ATP6 function

    • Systems biology modeling of ATP synthase integration with cellular metabolism

  • Organoid and Microfluidic Systems:

    • Tissue-specific organoids to study host-pathogen interactions

    • Microfluidic devices for real-time monitoring of fungal physiology

    • Gradient systems to analyze adaptation to changing environments

These emerging technologies will enable researchers to address previously intractable questions about ATP6 structure, function, and regulation in C. parapsilosis, potentially accelerating both fundamental understanding and translational applications.

What are the most promising research directions for understanding ATP6 role in C. parapsilosis pathogenicity?

Several high-priority research directions will advance our understanding of ATP6's role in C. parapsilosis pathogenicity:

  • Host-Pathogen Interaction Studies:

    • Investigate how ATP6 function influences survival within host immune cells

    • Determine whether ATP6-dependent energy production affects virulence factor expression

    • Analyze ATP6 mutants in relevant infection models to establish direct links to pathogenicity

  • Metabolic Adaptation Mechanisms:

    • Characterize how ATP6 contributes to adaptation to host microenvironments

    • Investigate the relationship between mitochondrial function and biofilm formation

    • Examine connections between ATP6 activity and alternative carbon metabolism during infection

  • Regulatory Network Integration:

    • Further dissect the unique regulatory mechanisms involving Met4 and Met28 in C. parapsilosis

    • Identify condition-specific transcription factors controlling ATP6 expression

    • Map the signaling pathways connecting environmental sensing to ATP6 regulation

  • Comparative Genomics Approaches:

    • Compare ATP6 sequence and regulation across Candida species with different pathogenicity profiles

    • Identify species-specific features that correlate with virulence potential

    • Use evolutionary analysis to pinpoint functionally important ATP6 domains

  • Drug Target Assessment:

    • Evaluate ATP6 as a potential antifungal target given its essential role in energy metabolism

    • Screen for compounds that specifically disrupt C. parapsilosis ATP6 function

    • Assess synergistic effects between ATP6 inhibitors and existing antifungals

These research directions will not only enhance our fundamental understanding of C. parapsilosis biology but may also reveal new strategies for therapeutic intervention against this emerging pathogen.

How might the unique regulatory mechanisms of C. parapsilosis ATP6 inform broader fungal biology research?

The distinctive regulatory features of ATP6 in C. parapsilosis offer valuable insights with broader implications for fungal biology:

  • Evolutionary Perspectives:

    • The unique dual regulatory system involving Met4 and Met28 provides a model for studying transcriptional network evolution

    • Comparing this system across fungal lineages may reveal how regulatory networks diversify

    • Understanding when and why C. parapsilosis evolved this distinctive regulation informs fungal evolutionary biology

  • Metabolic Integration Paradigms:

    • The unexpected connection between sulphur metabolism and mitochondrial function demonstrates novel metabolic integration

    • This linkage suggests unrecognized coordination between nutrient acquisition and energy production

    • Similar integrations may exist in other fungi but remain undetected due to focus on model organisms

  • Stress Adaptation Mechanisms:

    • The regulatory architecture may represent an adaptation to specific environmental pressures

    • Understanding these adaptations provides insights into how fungi colonize diverse niches

    • Knowledge of C. parapsilosis adaptations may predict similar mechanisms in emerging pathogens

  • Fungal Specialization Models:

    • C. parapsilosis represents a case study in how core cellular processes can be modified during specialization

    • The ATP6 regulatory mechanisms exemplify how conserved genes acquire new regulatory controls

    • This knowledge informs models of how opportunistic pathogens arise from environmental ancestors

  • Methodological Advances:

    • Techniques developed to study C. parapsilosis ATP6 regulation can be applied to other non-model fungi

    • Comparative approaches highlight the importance of studying diverse species beyond established models

    • Integration of genetic, transcriptomic, and biochemical methods provides a template for future studies

By studying these unique aspects of C. parapsilosis biology, researchers gain broader perspectives on fungal regulatory mechanisms, metabolic integration, and evolutionary processes that extend well beyond this specific organism.

What interdisciplinary approaches might yield new insights into ATP6 function in C. parapsilosis?

Integrating diverse disciplinary approaches offers powerful opportunities for advancing C. parapsilosis ATP6 research:

  • Systems Biology + Structural Biology:

    • Combine network analysis with structural studies to understand how ATP6 conformational changes propagate through cellular networks

    • Map structure-function relationships within the context of entire metabolic pathways

    • Develop predictive models connecting ATP6 structure to cellular phenotypes

  • Evolutionary Biology + Biochemistry:

    • Trace the evolutionary history of ATP6 across fungal lineages

    • Correlate sequence changes with biochemical properties and ecological niches

    • Reconstruct ancestral ATP6 sequences to test evolutionary hypotheses experimentally

  • Immunology + Mitochondrial Biology:

    • Investigate how ATP6-dependent mitochondrial function affects host immune recognition

    • Examine whether mitochondrial-derived damage-associated molecular patterns influence host responses

    • Determine if ATP6 variants correlate with immune evasion capabilities

  • Computational Chemistry + Genetics:

    • Apply molecular dynamics simulations to predict effects of ATP6 mutations

    • Design targeted mutations based on computational predictions

    • Validate in silico findings through precise genetic engineering

  • Microbial Ecology + Metabolomics:

    • Study how ATP6 function adapts to different ecological niches

    • Characterize metabolite profiles associated with ATP6 variants

    • Investigate competitive fitness in polymicrobial communities

  • Clinical Microbiology + Molecular Biology:

    • Analyze ATP6 sequences in clinical isolates with varying virulence

    • Correlate ATP6 variants with treatment outcomes

    • Develop diagnostic tools based on ATP6 function or regulation

The integration of these interdisciplinary approaches will provide multilevel insights into ATP6 biology in C. parapsilosis, potentially revealing unexpected connections and novel therapeutic opportunities against this important opportunistic pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.