Recombinant Candida parapsilosis Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant COX3 is synthesized using two primary systems:

Expression SystemHostYieldPurityTag
BacterialE. coliHigh>85%His-tag
EukaryoticBaculovirusModerate>85%His-tag
  • Storage: Lyophilized or in Tris-based buffer with 50% glycerol at -20°C/-80°C .

  • Reconstitution: Solubilized in deionized water, with glycerol added to prevent aggregation .

3.1. Fungal Pathogenesis Studies

  • Cell Wall Dynamics: COX3 interacts with mannosylation pathways (e.g., OCH1-dependent N-linked glycosylation) that modulate C. parapsilosis cell wall integrity and immune evasion .

  • Host Immune Interactions: COX3-deficient strains show altered β-glucan exposure, enhancing recognition by immune receptors (e.g., dectin-1 and TLR4) and cytokine production (e.g., IL-1β) .

3.2. Genomic and Evolutionary Analysis

  • Species Differentiation: Fixed SNPs in COX3 sequences distinguish C. parapsilosis subgroups (e.g., C. orthopsilosis and C. metapsilosis) .

  • Antifungal Resistance: Copy number variations (CNVs) in genes like RTA3 (linked to lipid translocases) correlate with hospital-adapted C. parapsilosis strains .

Comparative Genomic Insights

  • Sequence Conservation: COX3 exhibits higher variability in C. parapsilosis compared to C. albicans, making it a marker for phylogenetic studies .

  • Functional Complementation: C. parapsilosis OCH1 restores glycosylation defects in C. albicans och1Δ mutants, underscoring conserved roles in fungal biology .

Recombinant COX3 Variants

Product CodeSourceLengthApplications
RFL867CF E. coliFull-lengthHost interaction assays
CSB-BP656363CZK1 BaculovirusPartialStructural studies

Research Implications

  • Therapeutic Targets: COX3-associated pathways (e.g., oxidative phosphorylation) are potential targets for antifungal drug development .

  • Diagnostic Tools: COX3 polymorphisms aid in strain typing during nosocomial outbreaks .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Cytochrome oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Candida parapsilosis (Yeast)
Target Names
COX3
Target Protein Sequence
MTNNVRGYLQLHPFHLVGPSPWPIFTSFSLMDLAFSIALNSHGYMANNFYIILSIITVLY SMTLWFKDIIAESTYLGDHTIAVKRGLNQGFLLFVVSEILIFASLFWAYLHSAVNPTMDL GMSWPPVGIDVISPAELPLLNTIILLASGVTITYAHHALINGNRANTLYGFIYSTLLIAL FVMFQFLEYKYAGFTITDGVYGSTFYSLTGLHGLHMIMLTIMLVICTWRVYNYDFTNTSH VGAETTILYLHVLDVIWLFIYIIVYWWGS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of the cytochrome c oxidase complex, the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the respiratory chain component that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome c oxidase subunit 3 (COX3) in Candida parapsilosis?

Cytochrome c oxidase subunit 3 (Cox3p) is one of the core components of the mitochondrial respiratory complex IV (cytochrome c oxidase). In yeast systems, Cox3p forms part of a distinct assembly module that includes Cox3p, Cox4p, Cox7p, Cox13p, and the accessory factor Rcf1p . This module is critical for proper assembly of the holoenzyme.

In C. parapsilosis, Cox3p likely plays a similar role in cellular respiration, facilitating electron transfer and contributing to energy production. Unlike some other fungal metabolic pathways that show significant rewiring between species (as seen with the Met4/Met28 transcription factors in sulphur metabolism ), the fundamental respiratory functions are generally conserved, though specific regulatory mechanisms may differ.

How does COX3 in C. parapsilosis differ from its homologs in other Candida species?

While specific comparative data for C. parapsilosis COX3 is limited in the provided literature, we can infer some distinctions based on known differences between Candida species. C. parapsilosis shows unique transcriptional rewiring compared to C. albicans in several pathways, including hypoxic response and biofilm formation .

Research has demonstrated that despite phylogenetic relatedness, the pathobiology of C. parapsilosis cannot always be directly extrapolated from C. albicans . This suggests potential differences in the regulation and function of core proteins like Cox3p. The metabolic flexibility that allows C. parapsilosis to thrive in environments ranging from the human gut to soil and even rubber seals in washing machines may reflect adaptations in respiratory components, including COX3.

What experimental systems are commonly used to study recombinant C. parapsilosis COX3?

Research on yeast Cox3p has employed several experimental approaches that can be adapted for C. parapsilosis studies:

  • Gene tagging systems: Modification of the COX3 gene with tags such as polyhistidine or epitope tags (HA, protein C) at either C- or N-terminus for protein tracking and isolation .

  • Gene replacement methods: Substitution of native COX3 with marker genes like ARG8m to create null mutants for functional studies .

  • Mitochondrial isolation combined with spectral analysis: To measure cytochrome oxidase activity and abundance .

  • Pulse-labeling with radioactive amino acids: To track assembly intermediates and protein interactions .

The choice of experimental system depends on the specific research question, with considerations for potential growth defects that may result from Cox3p modifications, as observed with N-terminal tagging in yeast systems .

What are the optimal strategies for expressing recombinant C. parapsilosis COX3 while maintaining protein functionality?

Expressing functional recombinant Cox3p requires careful consideration of tag placement and expression systems. Based on yeast Cox3p studies, the following methodological approaches are recommended:

  • C-terminal tagging: Studies have shown that C-terminal polyhistidine tagging of Cox3p preserves growth rates comparable to wild type on glycerol/ethanol media, suggesting minimal impact on protein function .

  • Avoiding N-terminal modifications: N-terminal HAC (hemagglutinin-protein C) tagging resulted in approximately twofold reduction in mitochondrial cytochrome oxidase and slower growth , indicating potential disruption of function.

  • Verification of functionality: Always confirm the functionality of recombinant Cox3p through:

    • Growth phenotype analysis on non-fermentable carbon sources

    • Spectral analysis of cytochromes a and a3

    • Assembly assays to verify incorporation into higher-order complexes

  • Expression system selection: Consider using the native promoter and terminator regions to maintain physiological expression levels.

How can researchers effectively isolate and purify recombinant C. parapsilosis Cox3p for structural and functional studies?

The isolation of membrane proteins like Cox3p presents significant challenges. Based on successful approaches with yeast Cox3p, researchers should consider:

  • Affinity purification strategy using epitope tags:

    • Protein C antibody beads have been successfully used to purify Cox3p-HAC, allowing isolation of both the protein and its associated complexes

    • The method allows detection of assembly intermediates (C1-C4) and the fully assembled cytochrome c oxidase

  • Mitochondrial isolation protocol:

    • Isolate mitochondria using established differential centrifugation methods

    • Solubilize mitochondrial membranes with mild detergents like dodecyl maltoside

    • Apply solubilized material to appropriate affinity matrix

  • Analysis of purified products:

    • SDS-PAGE for protein purity assessment

    • Blue native PAGE for complex integrity evaluation

    • 2D gel electrophoresis (BN-PAGE followed by SDS-PAGE) to resolve subunit composition

This approach has successfully identified Cox3p-containing intermediates and complexes in yeast systems , and can be adapted for C. parapsilosis studies.

What techniques are most effective for studying Cox3p interactions with other subunits in the assembly module?

Understanding protein-protein interactions within the Cox3p assembly module requires specialized techniques:

  • Co-immunoprecipitation (Co-IP) with tagged Cox3p:

    • This has successfully demonstrated the association of Cox3p with Cox7p in yeast

    • Confirms the presence of other subunits (Cox4p, Cox13p) in the assembly module

  • Crosslinking mass spectrometry:

    • Allows identification of specific interaction points between Cox3p and other subunits

    • Provides structural insights that complement crystallographic data

  • Pulse-chase labeling with radioactive amino acids:

    • Enables tracking of newly synthesized Cox3p and its incorporation into assembly intermediates

    • Helps establish the temporal sequence of subunit association

  • Yeast two-hybrid and split-ubiquitin systems:

    • For studying binary interactions between Cox3p and other proteins

    • Particularly useful for identifying novel interaction partners

These approaches can reveal the Cox3p interactome in C. parapsilosis and potential differences from other Candida species that might contribute to its unique pathobiology.

How should researchers interpret growth defects in C. parapsilosis strains with modified COX3?

Growth defects in strains with modified COX3 require careful analysis to distinguish direct effects from secondary consequences. When evaluating growth phenotypes:

  • Compare multiple carbon sources:

    • Fermentable (glucose) vs. non-fermentable (glycerol/ethanol) media

    • Respiratory defects typically manifest more severely on non-fermentable carbon sources

  • Quantify growth parameters:

    • Doubling time

    • Lag phase duration

    • Maximum cell density

  • Assess mitochondrial function:

    • Measure oxygen consumption rates

    • Quantify cytochrome spectra to determine specific cytochrome oxidase levels

    • Evaluate mitochondrial membrane potential

  • Consider genetic background effects:

    • The diploid nature of Candida genomes can complicate interpretation if only one allele is modified

    • Heterozygosity may mask phenotypes or create dominant-negative effects

In yeast studies, N-terminal tagging of Cox3p resulted in approximately twofold reduction in mitochondrial cytochrome oxidase levels compared to C-terminal tagging , demonstrating how modification position can significantly affect interpretation of growth phenotypes.

What statistical approaches are most appropriate for analyzing Cox3p assembly intermediate data?

When analyzing Cox3p assembly intermediates (such as C1-C4 complexes observed in yeast ), appropriate statistical methods include:

  • Quantitative analysis of gel band intensities:

    • Use densitometry to quantify relative abundances of different intermediates

    • Apply normalization to account for differences in labeling efficiency or loading

  • Time-course analysis of assembly:

    • Fit kinetic models to pulse-chase data

    • Calculate rate constants for formation and disappearance of intermediates

  • Comparative analysis across strains:

    • ANOVA for comparing multiple strains/conditions

    • Consider non-parametric alternatives if assumptions are not met

  • Multivariate approaches:

    • Principal component analysis to identify patterns in complex assembly data

    • Cluster analysis to group similar assembly phenotypes

Assembly IntermediateMolecular Weight (kDa)CompositionRelative Abundance (Wild-type)Relative Abundance (Tagged Cox3p)
C1~100-150Cox3p and early interactors++
C2~200Cox3p, Cox4p, Cox7p+++++
C3~230Extended Cox3p module++++
C4~300Pre-holoenzyme complex++
COX (holoenzyme)~400Complete assembly+++++++

Note: This table represents a synthesis of information from yeast Cox3p studies and may require adjustment for C. parapsilosis-specific findings.

What are the main challenges in expressing recombinant Cox3p in C. parapsilosis and how can they be addressed?

Expressing recombinant Cox3p in C. parapsilosis presents several challenges:

  • Mitochondrial localization:

    • Cox3p is mitochondrially encoded and assembled in the inner mitochondrial membrane

    • Solution: Use mitochondrial targeting sequences if expressing from nuclear genes, or develop mitochondrial transformation methods

  • Potential toxicity:

    • Overexpression may disrupt respiratory chain balance

    • Solution: Use regulated promoters to control expression levels; consider inducible systems

  • Post-translational modifications:

    • Ensure necessary modifications occur correctly

    • Solution: Maintain native processing elements; consider co-expression of processing enzymes

  • Heterozygosity complications:

    • C. parapsilosis, like C. albicans, is diploid with potential allelic differences

    • Solution: Target both alleles or verify which allele is predominantly expressed

  • Species-specific factors:

    • C. parapsilosis has unique metabolic capabilities that may affect Cox3p function

    • Solution: Consider C. parapsilosis-specific chaperones or assembly factors

How can researchers distinguish between effects caused by COX3 modification and those resulting from general mitochondrial dysfunction?

Distinguishing direct COX3 effects from general mitochondrial dysfunction requires a multi-faceted approach:

  • Specific activity measurements:

    • Compare cytochrome c oxidase activity (Complex IV) with activities of other respiratory complexes

    • A selective defect in Complex IV suggests COX3-specific issues

  • Complementation studies:

    • Express wild-type COX3 in modified strains to verify phenotype rescue

    • Use COX3 from related species to assess functional conservation

  • Targeted assays:

    • Measure assembly of other respiratory complexes

    • Assess mitochondrial translation of other mitochondrially-encoded proteins

  • Microscopy techniques:

    • Evaluate mitochondrial morphology and distribution

    • Assess membrane potential with specific dyes

  • Transcriptional profiling:

    • Compare expression profiles of modified strains with known mitochondrial dysfunction mutants

    • Identify signature patterns specific to COX3 disruption versus general mitochondrial stress

What are the implications of C. parapsilosis's unique metabolic flexibility for COX3 function and research approaches?

C. parapsilosis demonstrates remarkable metabolic flexibility, allowing it to thrive in diverse environments . This has several implications for Cox3p research:

  • Respiratory adaptation:

    • C. parapsilosis may have evolved unique regulatory mechanisms for respiratory components

    • Research approach: Compare Cox3p regulation under various environmental conditions (pH, oxygen levels, carbon sources)

  • Biofilm relevance:

    • C. parapsilosis forms biofilms, which may involve metabolic adaptations including altered respiration

    • Research approach: Investigate Cox3p expression and function in planktonic versus biofilm growth

  • Virulence connection:

    • The pathogen's ability to adapt to host environments may involve respiratory flexibility

    • Research approach: Examine Cox3p role during host-pathogen interaction, particularly under oxidative stress

  • Antifungal targets:

    • Unique aspects of C. parapsilosis Cox3p could represent novel therapeutic targets

    • Research approach: Conduct comparative analysis with human Cox3p to identify pathogen-specific features

  • Metabolic network integration:

    • C. parapsilosis shows rewiring of metabolic pathways compared to other Candida species

    • Research approach: Study Cox3p in the context of broader metabolic networks, particularly during nutrient limitation

How might single-cell approaches advance our understanding of COX3 function in heterogeneous C. parapsilosis populations?

Single-cell technologies offer promising avenues for Cox3p research:

  • Single-cell transcriptomics:

    • Reveals population heterogeneity in COX3 expression

    • Can identify subpopulations with distinct respiratory states

    • May uncover condition-specific regulation patterns

  • Single-cell proteomics:

    • Quantifies Cox3p at the individual cell level

    • Correlates protein levels with phenotypic outcomes

    • Identifies rare cellular states that might be missed in bulk analyses

  • Microfluidic approaches:

    • Allow real-time tracking of individual cells

    • Enable correlation of Cox3p function with growth rates, morphology changes, and stress responses

    • Facilitate precise environmental manipulation

  • Single-cell metabolomics:

    • Connects Cox3p function to metabolic outputs

    • Helps establish causality in metabolic network relationships

These approaches are particularly relevant for C. parapsilosis given its known adaptability to diverse environments and potential phenotypic heterogeneity within populations.

What role might COX3 play in C. parapsilosis drug resistance and pathogenicity?

Understanding Cox3p's potential role in pathogenicity and drug resistance opens important research avenues:

  • Azole resistance connection:

    • C. parapsilosis shows concerning rates of azole resistance (>10% in some regions)

    • Research suggests respiratory adaptation can influence azole susceptibility

    • Investigate: Does altered Cox3p function affect azole resistance profiles?

  • Biofilm formation:

    • C. parapsilosis is notable for biofilm formation on medical devices

    • Respiratory adaptation often occurs in biofilms

    • Investigate: Does Cox3p expression or function change during biofilm development?

  • Host-pathogen interaction:

    • Mitochondrial function affects C. parapsilosis's ability to respond to host immune defenses

    • Investigate: How does Cox3p contribute to survival in macrophages or neutrophils?

  • Nosocomial transmission:

    • C. parapsilosis is particularly associated with horizontal transmission and outbreaks

    • Investigate: Does respiratory flexibility contribute to environmental persistence?

  • Treatment implications:

    • Understanding Cox3p function could reveal novel therapeutic targets

    • Investigate: Can Cox3p inhibition sensitize resistant strains to existing antifungals?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.