Recombinant Candida parapsilosis NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Candida parapsilosis (Yeast)
Target Names
ND3
Target Protein Sequence
MFTAYLILCPIIAVVLVGLNWLLATSNSYIEKDGPFECGFTSFQQSRSAFSVAFILVAIL FLPFDLEISSILPFVISPYSNGLYGLVILVIFLILLIVAFVVEIQLKALQLNRTYTNDLP HTELYDININD
Uniprot No.

Target Background

Function

Recombinant Candida parapsilosis NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-ubiquinone oxidoreductase chain 3 (ND3) in Candida parapsilosis mitochondria?

ND3 is a mitochondrially-encoded component of the respiratory Complex I in Candida parapsilosis. It belongs to the proton-pumping NADH:ubiquinone oxidoreductase system essential for electron transport and ATP production. Like in other Candida species, Complex I in C. parapsilosis contains core subunits that originated from a bacterial progenitor, with ND3 being one of the critical components involved in the proton translocation process across the inner mitochondrial membrane. The protein is part of the membrane arm (P module) of Complex I that is responsible for creating the proton gradient necessary for ATP synthesis. In Candida albicans, seven of the 14 core Complex I genes are encoded by mitochondrial DNA, including components similar to ND3 . Defects in Complex I components significantly impair respiratory function, which consequently affects virulence and pathogenicity.

How does recombinant expression of ND3 from C. parapsilosis differ from expression of other Candida proteins?

Recombinant expression of mitochondrially-encoded proteins like ND3 presents unique challenges compared to nuclear-encoded proteins. As a highly hydrophobic membrane protein, ND3 requires specialized expression systems that can properly integrate the protein into membranes. Unlike many nuclear-encoded Candida proteins that can be expressed in standard bacterial or yeast systems, ND3 often requires:

  • Codon optimization for the expression host due to differences in mitochondrial genetic code

  • Addition of solubilization tags or fusion partners to prevent aggregation

  • Use of specialized membrane-protein expression hosts such as C43(DE3) E. coli strains

  • Incorporation of specific detergents during purification to maintain protein stability

The expression challenges are comparable to those faced when working with other mitochondrially-encoded Complex I subunits in Candida albicans, where assembly and stability depend on interactions with multiple protein partners .

What purification methods yield the highest activity for recombinant C. parapsilosis ND3?

Purification of recombinant ND3 requires a carefully optimized protocol to maintain protein integrity and activity:

Recommended Purification Protocol:

  • Initial extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that preserve membrane protein structure

  • Affinity chromatography: His-tag purification under optimized detergent conditions

  • Size exclusion chromatography: To separate properly folded protein from aggregates

  • Activity assessment: NADH:ubiquinone oxidoreductase activity assays following purification

Activity Preservation Factors:

  • Maintaining pH between 7.2-7.5 throughout purification

  • Including phospholipids like cardiolipin during purification

  • Adding 10-20% glycerol to all buffers to enhance stability

  • Keeping temperatures between 4-10°C during all purification steps

When properly purified, recombinant ND3 can be reconstituted with other Complex I components to study assembly and function, similar to approaches used with Candida albicans Complex I subunits .

How can recombinant ND3 be used to investigate the contribution of Complex I to C. parapsilosis virulence?

Recombinant ND3 provides a valuable tool for investigating the relationship between mitochondrial function and virulence in C. parapsilosis. Research approaches include:

Experimental Approaches:

  • In vitro reconstitution studies: Combining recombinant ND3 with other Complex I components to measure electron transport activity and proton pumping efficiency

  • Protein-protein interaction assays: Using tagged recombinant ND3 to identify binding partners unique to C. parapsilosis compared to other Candida species

  • Structure-function studies: Site-directed mutagenesis of conserved domains to assess impact on complex assembly and activity

Research Applications:

  • Virulence correlation: Studies can correlate Complex I activity with virulence attributes like biofilm formation. Recent research demonstrates that fluconazole-resistant C. parapsilosis isolates exhibit increased biofilm formation capacity, possibly linked to metabolic adaptation involving mitochondrial function .

  • Comparative analysis: Cross-species comparison of ND3 function between C. parapsilosis, C. albicans, and other members of the psilosis complex (C. orthopsilosis and C. metapsilosis) to understand species-specific virulence mechanisms .

  • Immune interaction studies: Investigating how Complex I activity influences host-pathogen interactions and immune recognition, similar to studies conducted with other Candida virulence factors .

What role might ND3 and Complex I play in antifungal resistance in C. parapsilosis?

Complex I function may contribute to antifungal resistance through several mechanisms:

Potential Resistance Mechanisms:

  • Energy-dependent efflux pumps: Complex I provides ATP necessary for the function of drug efflux pumps like CDR1, which is known to be mutated in resistant C. parapsilosis strains .

  • Metabolic adaptation: Altered mitochondrial function may help C. parapsilosis adapt to antifungal stress by modifying energy metabolism pathways.

  • Oxidative stress response: Complex I is a major source of reactive oxygen species (ROS) in mitochondria. Mutations affecting ND3 could alter ROS production, affecting cellular stress responses that contribute to antifungal resistance.

Research Evidence:

Recent studies demonstrate that fluconazole-resistant C. parapsilosis isolates show various adaptations including altered ergosterol content and cell wall properties . While a direct correlation between these changes and Complex I function has not been established specifically for ND3, studies in C. albicans have shown that mutations in Complex I components like Nuo1p and Nuo2p significantly impact stress resistance .

The table below summarizes key differences observed between fluconazole-sensitive and resistant C. parapsilosis isolates that may relate to mitochondrial function:

CharacteristicFluconazole-Sensitive IsolatesFluconazole-Resistant IsolatesPotential Relation to Complex I
Biofilm formationLower potentialSignificantly higher potential (p = 0.0055)Altered energy metabolism affecting biofilm matrix production
Ergosterol contentVariable (no consistent pattern)Variable (no consistent pattern)Complex I function affecting lipid metabolism pathways
Cell surface integrityMore susceptible to SDS disruptionSome isolates (R3) more resistant to SDSMitochondrial function influencing cell wall biosynthesis

What experimental approaches are most effective for characterizing the assembly of recombinant ND3 into functional Complex I?

Characterizing the assembly of recombinant ND3 into functional Complex I requires specialized techniques:

Recommended Methodological Approaches:

  • Blue Native PAGE: This technique allows visualization of intact Complex I and assembly intermediates containing ND3.

  • Supercomplex analysis: To determine how ND3 incorporation affects the formation of respiratory supercomplexes.

  • Pulse-chase assembly assays: Using radiolabeled recombinant ND3 to track its incorporation into Complex I over time.

  • In vitro reconstitution: Systematic assembly of Complex I components with recombinant ND3 to identify assembly partners and sequence.

Assembly Factor Considerations:

Research on C. albicans has revealed that Complex I assembly requires specific factors. For example, Ndufaf5, which contains an S-adenosylmethionine-dependent methyltransferase domain, is required for the insertion of mitochondrially-encoded subunits into the membrane arm in mammals, and a paralog has been identified in Candida . Similar assembly pathways likely exist for C. parapsilosis ND3, making it important to investigate species-specific assembly factors.

How do mutations in ND3 affect electron transport and ATP production in azole-resistant C. parapsilosis strains?

Mutations in ND3 can have profound effects on electron transport and energy production, potentially contributing to azole resistance:

Experimental Assessment Approaches:

  • Site-directed mutagenesis: Introduction of specific mutations identified in resistant clinical isolates into recombinant ND3.

  • Oxygen consumption measurements: Real-time analysis of respiratory capacity in reconstituted systems containing wild-type versus mutant ND3.

  • NADH:ubiquinone oxidoreductase activity assays: Quantification of electron transfer rates in isolated complexes.

  • Proton pumping efficiency: Measurement of proton gradient formation using pH-sensitive fluorescent probes.

Correlation with Resistance:

While the search results don't specifically mention ND3 mutations in resistant C. parapsilosis strains, they do document mutations in genes involved in ergosterol biosynthesis (ERG6, ERG11) and drug transport (CDR1) . Both pathways require ATP, suggesting that alterations in energy metabolism through Complex I modifications could support resistance mechanisms. Additionally, in C. albicans, mutations in Complex I components like Ndh51p, Nuo1p, and Nuo2p have been shown to affect mitochondrial function and can induce compensatory mechanisms involving assembly factors like Ndufaf2 .

What are the key structural and functional differences of ND3 among members of the Candida parapsilosis complex?

The C. parapsilosis complex consists of three closely related species: C. parapsilosis sensu stricto, C. orthopsilosis, and C. metapsilosis. Understanding ND3 differences among these species provides insights into their divergent pathogenicity:

Comparative Analysis Approaches:

  • Sequence alignment analysis: Identification of conserved versus variable regions in ND3 across the psilosis complex species.

  • 3D structural modeling: Prediction of structural differences and their potential impact on Complex I assembly and function.

  • Heterologous expression: Expressing ND3 from different complex members in the same background to assess functional differences.

Phylogenetic Context:

Recent genomic and phylogenetic analyses reveal that C. orthopsilosis and C. metapsilosis are often misidentified as C. parapsilosis in clinical settings . While they share many genetic characteristics, the functional differences in their mitochondrial components like ND3 remain understudied. Given that C. parapsilosis shows higher prevalence and often greater virulence than its close relatives, comparative analysis of Complex I function could reveal important species-specific adaptations .

What expression systems yield the highest functional recombinant ND3 from C. parapsilosis?

Several expression systems have been evaluated for the production of mitochondrial membrane proteins like ND3:

Expression System Comparison Table:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli C43(DE3)- High yield
- Economical
- Well-established protocols
- Improper folding possible
- Lacks eukaryotic post-translational modifications
- Codon optimization
- Reduced induction temperature (16-20°C)
- Addition of membrane-mimicking detergents
Saccharomyces cerevisiae- Eukaryotic system
- Better protein folding
- More similar membrane composition
- Lower yields than E. coli
- Slower growth
- More expensive
- Use of strong inducible promoters
- Optimization of growth media
- Selection of appropriate host strains
Pichia pastoris- High cell density cultures
- Strong methanol-inducible promoter
- Efficient secretion
- Complex media requirements
- Methanol hazards
- Lengthy optimization needed
- Use of multi-copy integrants
- Controlled feeding strategies
- Optimized induction protocols
Cell-free systems- Rapid expression
- Direct incorporation into liposomes
- Avoids toxicity issues
- Expensive
- Limited scale
- Technical complexity
- Addition of membrane mimetics
- Optimization of translation components
- Incorporation of chaperones

Recommended Approach:

For functional studies of C. parapsilosis ND3, a Pichia pastoris system with codon-optimized constructs often provides the best balance between yield and proper folding. Including a removable purification tag and expressing the protein with a TEV protease cleavage site allows for efficient purification while minimizing interference with protein function.

How can recombinant ND3 be used to screen for novel antifungal compounds targeting Complex I?

Recombinant ND3 provides opportunities for antifungal drug discovery targeting mitochondrial function:

Screening Methodologies:

  • High-throughput binding assays: Using fluorescently-labeled recombinant ND3 to identify compounds that specifically bind to the protein.

  • Complex I inhibition assays: Measuring NADH oxidation rates in reconstituted systems containing recombinant ND3 in the presence of candidate inhibitors.

  • Thermal shift assays: Assessing compound binding through changes in protein thermal stability.

  • Structure-based virtual screening: Using ND3 structural models to computationally identify potential binding compounds.

Target Validation Approaches:

The potential of Complex I as an antifungal target is supported by research showing that C. albicans mutants lacking key Complex I components (goa1Δ, nuo1Δ, nuo2Δ) are avirulent in mouse models of disseminated candidiasis . Similar studies have not been published specifically for C. parapsilosis ND3, but the evolutionary conservation of Complex I function suggests that compounds targeting this protein could have broad antifungal activity.

Importantly, since Complex I components like Nuo1p and Nuo2p are absent in mammals, drugs targeting fungal-specific Complex I subunits could offer selective antifungal activity with reduced host toxicity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.