Recombinant Candida parapsilosis NADH-ubiquinone oxidoreductase chain 6 (ND6)

What is Candida parapsilosis NADH-ubiquinone oxidoreductase chain 6 (ND6) and what is its role in cellular function?

NADH-ubiquinone oxidoreductase chain 6 (ND6) in Candida parapsilosis is a mitochondrial protein that functions as a critical subunit of Complex I in the electron transport chain. Similar to its human counterpart MT-ND6, this protein is embedded in the inner mitochondrial membrane and plays an essential role in cellular respiration and energy production. The protein is hydrophobic in nature, consisting of 155 amino acids with a molecular weight of approximately 18 kDa . ND6 participates in the transfer of electrons from NADH to ubiquinone (coenzyme Q10), contributing to the generation of the proton gradient necessary for ATP synthesis. The protein's sequence contains multiple transmembrane domains that anchor it within the mitochondrial membrane, forming part of the core structure of the respiratory Complex I in C. parapsilosis.

How does the structure of recombinant C. parapsilosis ND6 compare to native ND6?

Recombinant C. parapsilosis ND6 protein typically includes a His-tag at the N-terminus to facilitate purification, which is not present in the native protein . The full-length recombinant protein (amino acids 1-155) maintains the primary sequence of the native protein with the addition of the affinity tag. The amino acid sequence (MFLISGISSILAIGLLSPVQSIVCLIVLFVSAAISLYSNGFVLMGILYVLIYVGAIAILFFLFILSLLNIEYNYKGTIHPLIFTILIICLIPLDLSYETYGIVENVNIAYPFNSLLDWDLELTTVGSLLYTEYAIPMILIGLILILSVIGAIAITK) reveals its highly hydrophobic nature, characteristic of mitochondrial membrane proteins . When expressed in E. coli, proper folding must be carefully monitored, as heterologous expression systems may produce structural differences compared to the native protein found in C. parapsilosis mitochondria. Researchers must consider these potential structural variations when designing experiments using the recombinant protein.

What are the optimal conditions for expression and purification of recombinant C. parapsilosis ND6?

For optimal expression of recombinant C. parapsilosis ND6, E. coli is the recommended heterologous system, with BL21(DE3) strains being particularly effective for membrane protein expression . The expression protocol should include:

• Transformation of expression vector containing the ND6 coding sequence with N-terminal His-tag into competent E. coli cells

• Culture growth at 37°C until OD600 reaches 0.6-0.8

• Temperature reduction to 16-18°C before induction with 0.1-0.5 mM IPTG

• Extended expression period (16-20 hours) at the reduced temperature to enhance proper folding

For purification:

• Cell lysis using a combination of detergents (typically 1% DDM or 1% Triton X-100)

• Metal affinity chromatography using Ni-NTA resin

• Buffer optimization containing 0.05-0.1% mild detergent to maintain protein solubility

• Size exclusion chromatography for further purification

The final purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and aliquoted with 5-50% glycerol for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles .

What analytical techniques are most effective for characterizing recombinant C. parapsilosis ND6?

Multiple complementary analytical techniques are recommended for comprehensive characterization of recombinant C. parapsilosis ND6:

For structural studies, a combination of cryo-electron microscopy and X-ray crystallography may be attempted, though the hydrophobic nature of ND6 poses significant challenges for crystallization. Functional characterization should include assessment of electron transfer capacity using NADH oxidation assays and membrane potential measurements in reconstituted systems.

How does ND6 contribute to C. parapsilosis pathogenicity and virulence?

ND6, as part of the mitochondrial respiratory Complex I, plays an indirect yet significant role in C. parapsilosis pathogenicity through several mechanisms:

• Energy production: ND6 contributes to ATP synthesis, providing the energy required for various virulence factors including biofilm formation, which is a critical virulence determinant in C. parapsilosis .

• Stress adaptation: The electron transport chain, including ND6, is implicated in the ability of C. parapsilosis to withstand oxidative stress during host-pathogen interactions. Resistant strains of C. parapsilosis exhibit altered bioenergetic profiles that may involve modifications in ND6 function .

• Metabolic flexibility: ND6's role in respiration contributes to the pathogen's ability to adapt to different nutritional environments within the host, particularly important for an opportunistic pathogen like C. parapsilosis .

Comparative studies between C. parapsilosis and C. albicans suggest species-specific differences in metabolic regulation that influence virulence patterns, with unique transcription factors controlling biofilm formation and other pathogenicity attributes in C. parapsilosis .

What is known about ND6 mutations and their impact on antifungal resistance in C. parapsilosis?

While direct mutations in ND6 have not been specifically identified as primary determinants of antifungal resistance in C. parapsilosis, whole genome sequencing studies have revealed several mutations in genes associated with resistance mechanisms. Fluconazole-resistant C. parapsilosis isolates exhibit mutations in key genes such as ERG11, ERG6, CDR1, and UPC2 . These mutations affect ergosterol biosynthesis and drug efflux, two major mechanisms of azole resistance.

The relationship between mitochondrial function and antifungal resistance is complex:

• Altered respiratory function may contribute to changes in membrane composition, affecting drug permeability

• Energy-dependent drug efflux systems require adequate ATP production, involving mitochondrial complexes

• Mutations in mitochondrial genes may contribute to phenotypic adaptations associated with resistance

Research indicates that resistant C. parapsilosis isolates show increased biofilm formation compared to sensitive isolates , suggesting a potential link between resistance mechanisms and other virulence factors that may indirectly involve mitochondrial proteins like ND6.

How can researchers effectively study ND6 in the context of C. parapsilosis biofilm formation?

Studying ND6 in the context of C. parapsilosis biofilm formation requires multidisciplinary approaches:

• Gene deletion and complementation studies:

  • Create ND6 knockout strains using CRISPR-Cas9 or homologous recombination

  • Perform phenotypic characterization focusing on biofilm formation capacity

  • Complement mutants with wild-type or modified ND6 genes to confirm specificity

• Biofilm formation assays:

  • Crystal violet staining to quantify total biofilm mass

  • XTT reduction assay to measure metabolic activity within biofilms

  • Confocal microscopy with fluorescent stains to analyze biofilm architecture

• Transcriptional profiling:

  • RNA-Seq analysis comparing ND6 mutants with wild-type strains during biofilm formation

  • Focus on differential expression of known biofilm regulators such as BCR1, CPH2, CZF1, GZF3, and UME6

  • Correlate findings with transcription profiles of C. albicans to identify species-specific patterns

• Metabolic analysis:

  • Oxygen consumption measurements to assess respiratory function

  • ATP quantification to evaluate energy production during biofilm formation

  • Metabolomic profiling to identify altered metabolic pathways in ND6 mutants

Researchers should note that C. parapsilosis biofilm formation involves unique transcription factors compared to C. albicans, with seven transcription factors (including EFG1, BCR1, ACE2, CPH2, CZF1, GZF3, and UME6) and one protein kinase specifically required for C. parapsilosis biofilm development .

What approaches are effective for studying the role of ND6 in mitochondrial function and respiratory chain assembly?

To effectively study ND6's role in mitochondrial function and respiratory chain assembly in C. parapsilosis:

• Mitochondrial isolation and fractionation:

  • Differential centrifugation to isolate intact mitochondria

  • Solubilization with mild detergents to extract membrane complexes

  • Blue native PAGE to analyze intact respiratory complexes

• Respiratory chain activity measurements:

  • Oxygen consumption using Clark-type electrodes

  • Complex I-specific activity assays using NADH oxidation

  • Measurement of mitochondrial membrane potential with fluorescent probes

• Structural analysis of Complex I:

  • Cryo-electron microscopy of isolated Complex I

  • Cross-linking studies to identify ND6 interacting partners

  • Identification of assembly intermediates in ND6 mutants

• In vivo functional assessment:

  • Growth assays on fermentable versus non-fermentable carbon sources

  • ROS production measurements using fluorescent probes

  • Assessment of mitochondrial morphology using electron microscopy

• Comparative analysis with other Candida species:

  • Alignment of ND6 sequences across Candida species

  • Functional complementation studies with orthologous genes

  • Evaluation of species-specific differences in Complex I structure and function

These approaches should be integrated with genetic manipulation strategies, including site-directed mutagenesis of conserved ND6 residues to identify functionally critical domains.

What are common challenges in working with recombinant ND6 and how can they be addressed?

Working with recombinant ND6 presents several challenges due to its hydrophobic nature and membrane localization:

• Protein solubility issues:

  • Challenge: ND6's hydrophobicity often leads to aggregation and inclusion body formation

  • Solution: Express at lower temperatures (16-18°C), use specialized E. coli strains (C41, C43), and include solubility-enhancing fusion tags beyond His-tag (MBP, SUMO)

• Proper folding:

  • Challenge: Membrane proteins frequently misfold when overexpressed

  • Solution: Include appropriate detergents during purification (DDM, LMNG), consider membrane-mimetic environments (nanodiscs, liposomes) for storage and functional studies

• Yield limitations:

  • Challenge: Low expression yields typical of membrane proteins

  • Solution: Optimize codon usage for E. coli, use strong inducible promoters with fine-tuned induction conditions, scale up culture volumes

• Functional reconstitution:

  • Challenge: Isolated ND6 may not retain native activity without other Complex I components

  • Solution: Co-express with interacting partners, reconstitute into proteoliposomes, or study within partial complexes

• Stability during storage:

  • Challenge: Recombinant ND6 may denature during freeze-thaw cycles

  • Solution: Store in buffer containing 6% trehalose, pH 8.0, with 50% glycerol, make single-use aliquots, and avoid repeated freeze-thaw cycles

How can researchers design effective controls for ND6 functional studies?

Designing appropriate controls is critical for ND6 functional studies:

• Positive and negative protein controls:

  • Include well-characterized membrane proteins expressed under identical conditions

  • Use denatured ND6 as negative control for activity assays

  • Include commercially available Complex I from related organisms as reference

• Genetic controls:

  • Generate point mutants in conserved residues as comparative controls

  • Create truncated versions of ND6 to identify functional domains

  • Use site-directed mutagenesis to modify known functional sites

• Experimental controls:

  • Run parallel experiments with specific inhibitors of Complex I (rotenone, piericidin A)

  • Include background strain controls without the target protein expression

  • Perform mock purifications from non-transformed cells

• Validation controls:

  • Verify protein identity using mass spectrometry

  • Confirm tag accessibility with anti-tag antibodies

  • Assess complex formation using size exclusion chromatography

• Normalizing parameters:

  • Standardize protein concentration across experiments

  • Account for batch variation by normalizing to internal standards

  • Include technical and biological replicates with appropriate statistical analysis

These controls help distinguish specific ND6-related effects from experimental artifacts, ensuring robust and reproducible results in complex functional studies.