Recombinant Candida tropicalis Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped on blue ice unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements; we will prioritize fulfilling custom tag requests.
Synonyms
AIM11; CTRG_02641; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)
Target Names
AIM11
Target Protein Sequence
MSTFLQSFKISQASDEYKQRRKTQMLKFFTASAITILTSRFAYRSTIARQYVPTLFQGNH SPPLSYNFTTDAAVAVATGTILCGSVSSMLVLGGFWILDVSNLGEFGWRMKEKLGGLEKE KHLGEMEMDEESRYIQDSLNDLLDGKYDFEEEGGNNSVA
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of AIM11 in C. tropicalis mitochondria?

AIM11 in C. tropicalis is part of the mitochondrial proteome involved in maintaining proper mitochondrial inheritance and function. Like other AIM proteins identified in yeast species, it likely plays a role in mitochondrial biogenesis, morphology, and inheritance pathways. The protein appears to be involved in maintaining mitochondrial genome stability and may influence cellular respiration efficiency. In the context of C. tropicalis virulence, mitochondrial proteins like AIM11 may contribute to stress adaptation and antifungal resistance mechanisms, as mitochondrial function is critical for cellular energy production during infection processes .

How is C. tropicalis typically genotyped and characterized in research settings?

C. tropicalis can be genotyped through several molecular methods. Random Amplified Polymorphic DNA (RAPD) is commonly employed with various primers such as OPA-18, OPE-18, and P4 to evaluate genetic variability. Studies have demonstrated that these analyses can generate well-defined clusters with varying degrees of similarity. For example, analysis using the OPA-18 primer showed four distinct clusters with 70-90% similarity among clinical isolates . Additionally, Multilocus Sequence Typing (MLST) is used to determine diploid sequence types (DSTs), which are valuable for phylogenetic analysis and strain identification. The unweighted pair group method with arithmetic means (UPGMA) algorithm is frequently applied for phylogenetic analysis, with a cutoff p-distance value of 0.01 separating distinct clades .

What expression systems are most effective for recombinant C. tropicalis proteins?

For recombinant expression of C. tropicalis proteins, several expression systems have proven effective. While Escherichia coli remains a common platform for initial expression attempts, yeast-based expression systems often provide better results for fungal proteins that require eukaryotic post-translational modifications. Saccharomyces cerevisiae and Pichia pastoris expression systems are particularly valuable for mitochondrial proteins like AIM11, as they provide the proper cellular environment for correct folding and modifications. For mitochondrial targeting, incorporating the native mitochondrial targeting sequence is essential. Expression vectors containing strong inducible promoters (like GAL1 for S. cerevisiae or AOX1 for P. pastoris) with appropriate selectable markers facilitate efficient protein production. Codon optimization based on the host organism's preference can significantly improve expression levels .

What are the key phenotypic characteristics of C. tropicalis that researchers should monitor?

Researchers studying C. tropicalis should monitor several key phenotypic characteristics:

  • Biofilm formation: C. tropicalis is recognized as a strong biofilm producer, often surpassing C. albicans in this capacity. Biofilm production can be classified as moderate to strong, and this characteristic is particularly relevant for clinical isolates .

  • Antifungal susceptibility: Monitoring minimum inhibitory concentration (MIC) values for azoles (fluconazole, voriconazole), echinocandins, and amphotericin B is essential. For example, fluconazole MICs can range from 8 to >64 mg/L in resistant isolates .

  • Morphological transitions: The bud-to-hyphae transition (morphogenesis) is an important virulence factor.

  • Enzymatic activity: Production of lytic enzymes such as proteinases, phospholipases, and hemolysins should be assessed .

  • Growth in high-salt environments: C. tropicalis is osmotolerant, which may contribute to its persistence in certain environments .

What strategies can overcome expression challenges for AIM11 in heterologous systems?

Expressing mitochondrial proteins like AIM11 in heterologous systems presents several challenges that can be addressed through strategic approaches. For optimal expression, consider the following methodological solutions:

  • Expression construct design: Utilize a dual-tagging approach with an N-terminal tag (e.g., His6) and a C-terminal tag (e.g., FLAG) to verify full-length protein expression and facilitate purification. Include TEV protease cleavage sites for tag removal during purification.

  • Induction optimization: For yeast-based expression systems, perform a time-course experiment with varying inducer concentrations (0.1-2% galactose for GAL1 promoter) and induction temperatures (18-30°C). Lower temperatures (18-22°C) often improve folding of mitochondrial membrane proteins.

  • Growth conditions: Since C. tropicalis demonstrates condition-dependent protein expression patterns, test multiple carbon sources (glucose, glycerol, lactate) to optimize mitochondrial protein yield. For example, mitochondrial ribosomes and MICOS complex components show carbon source-dependent expression patterns .

  • Co-expression with chaperones: Co-express with mitochondrial chaperones like mtHsp70 (encoded by SSC1 in yeast) to improve folding and stability of AIM11.

  • Solubilization optimization: Test a panel of detergents for membrane-associated proteins, including mild detergents like DDM (n-Dodecyl β-D-maltoside) at 0.5-1% and LMNG (Lauryl Maltose Neopentyl Glycol) at 0.01-0.05% .

How can researchers verify the integrity and functionality of purified recombinant AIM11?

Verifying the integrity and functionality of purified recombinant AIM11 requires a multi-faceted approach:

  • Protein integrity assessment:

    • SDS-PAGE and Western blotting with antibodies against N- and C-terminal tags to confirm full-length expression

    • Mass spectrometry (MS) analysis for accurate molecular weight determination and peptide mapping

    • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

  • Functional verification:

    • ATPase activity assays if AIM11 possesses predicted enzymatic functions

    • Liposome binding assays to test membrane interaction capabilities

    • Protein-protein interaction studies with known mitochondrial partners using pull-down assays

  • Structural validation:

    • Limited proteolysis to evaluate folding quality (well-folded proteins typically generate discrete fragmentation patterns)

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

The combination of these approaches provides comprehensive verification of both structural integrity and functional activity of the recombinant protein.

What are the critical factors in designing C. tropicalis knockout and complementation systems for AIM11 studies?

Designing effective knockout and complementation systems for AIM11 studies in C. tropicalis requires careful consideration of several critical factors:

  • Knockout strategy design:

    • Utilize CRISPR-Cas9 system with C. tropicalis-optimized promoters for Cas9 expression

    • Design guide RNAs targeting conserved regions of AIM11 with minimal off-target effects

    • Include selectable markers (NAT1 or SAT1) flanked by FRT sites for marker recycling

    • Verify knockouts by PCR, Southern blotting, and RT-PCR

  • Complementation vector construction:

    • Use integration at neutral genomic loci (e.g., RPS1) for stable expression

    • Include native promoter and terminator sequences for physiological expression levels

    • Consider epitope tagging (C-terminal HA or FLAG) for protein detection while preserving mitochondrial targeting

    • Include fluorescent protein fusions for localization studies

  • Phenotypic validation assays:

    • Mitochondrial morphology assessment using MitoTracker staining

    • Respiratory capacity measurement via oxygen consumption rate

    • Stress response assays (oxidative, osmotic, temperature)

    • Antifungal susceptibility testing, as alterations in mitochondrial function might affect resistance profiles

  • Expression verification:

    • Quantitative real-time PCR for transcript levels

    • Western blotting for protein expression

    • Fluorescence microscopy for localization confirmation

These methodological approaches ensure rigorous verification of gene deletion and proper complementation, which are essential for reliable functional studies of AIM11.

What techniques are most effective for studying AIM11 localization within C. tropicalis mitochondria?

Several complementary techniques can be employed to effectively study AIM11 localization within C. tropicalis mitochondria:

  • Subcellular fractionation and Western blotting:

    • Isolate highly purified mitochondria using differential centrifugation

    • Further fractionate mitochondria into outer membrane, inner membrane, intermembrane space, and matrix components

    • Analyze fractions by SDS-PAGE and Western blotting with antibodies against tagged AIM11

    • Include controls for each compartment (e.g., Por1 for outer membrane, Cox2 for inner membrane)

  • Protease protection assays:

    • Treat intact and osmotically shocked mitochondria with increasing concentrations of proteases (e.g., Proteinase K)

    • Monitor degradation patterns to determine membrane protection of AIM11

  • Fluorescence microscopy:

    • Express AIM11 fused to fluorescent proteins (GFP/mCherry)

    • Co-localize with established mitochondrial markers

    • Use super-resolution microscopy for precise submitochondrial localization

  • Immunoelectron microscopy:

    • Label AIM11 with gold-conjugated antibodies

    • Visualize precise submitochondrial localization at nanometer resolution

  • Proximity labeling techniques:

    • Fuse AIM11 to enzymes like BioID or APEX2

    • Identify neighboring proteins through biotinylation and subsequent mass spectrometry

Research on mitochondrial proteome analysis has demonstrated that submitochondrial protein profiling using these techniques effectively distinguishes proteins in different mitochondrial compartments. For example, complex components like TIM23-PAM, MICOS, and mitochondrial ribosomes display characteristic distribution patterns in proteome profiling experiments .

How can researchers assess the impact of AIM11 deletion on mitochondrial function and C. tropicalis virulence?

Assessing the impact of AIM11 deletion requires a comprehensive approach combining mitochondrial function and virulence assays:

  • Mitochondrial function assessment:

    • Oxygen consumption rate measurement using Clark-type electrode or Seahorse XF analyzer

    • Membrane potential analysis using fluorescent dyes (TMRM, JC-1)

    • ATP production quantification

    • ROS production measurement using MitoSOX or DCF-DA

    • mtDNA stability and copy number analysis

  • Mitochondrial morphology analysis:

    • Confocal microscopy with mitochondrial markers

    • Electron microscopy for ultrastructural changes

    • Quantification of fusion/fission events

  • Stress response assays:

    • Growth under oxidative stress (H₂O₂, menadione)

    • Carbon source utilization (glucose vs. non-fermentable carbon sources)

    • Temperature sensitivity (30°C, 37°C, 42°C)

    • Osmotic stress response (NaCl, sorbitol)

  • Virulence factor assessment:

    • Biofilm formation quantification using crystal violet staining

    • Hyphal formation in inducing media

    • Enzymatic activity measurement (proteinases, phospholipases, hemolysins)

    • Adhesion to epithelial and endothelial cells

  • In vivo virulence models:

    • Galleria mellonella infection model

    • Murine systemic and mucosal infection models

    • Tissue burden and histopathology analysis

Assay TypeWild-type C. tropicalisAIM11 Deletion MutantComplemented Strain
Oxygen Consumption (nmol O₂/min/10⁶ cells)25-30 (expected range)To be determinedTo be determined
Biofilm Formation (OD590)0.8-1.2 (strong producer)To be determinedTo be determined
Growth on Glycerol (doubling time, h)3-4 (expected)To be determinedTo be determined
Azole Susceptibility (MIC, mg/L)0.5-16 (variable)To be determinedTo be determined

What specific molecular interactions should be investigated to understand AIM11's role in mitochondrial inheritance?

To comprehensively understand AIM11's role in mitochondrial inheritance, several key molecular interactions should be investigated:

  • Protein-protein interactions:

    • Identify interaction partners using techniques like BioID, co-immunoprecipitation, or yeast two-hybrid screening

    • Focus on known mitochondrial inheritance machinery components (e.g., Mmm1, Mdm10, Mdm12, Mdm34)

    • Investigate interactions with mitochondrial outer membrane proteins involved in tethering

    • Examine potential associations with cytoskeletal components, particularly actin, which is involved in mitochondrial movement

  • Protein-lipid interactions:

    • Assess binding to specific phospholipids using liposome binding assays

    • Investigate cardiolipin interactions, as this phospholipid is critical for many mitochondrial processes

    • Study potential roles in maintaining membrane architecture at contact sites

  • DNA-protein interactions:

    • Examine potential binding to mtDNA nucleoids

    • Investigate role in mtDNA stability and inheritance

  • Dynamic association studies:

    • Perform time-lapse microscopy to track AIM11 during cell division

    • Use photoactivatable fluorescent proteins to monitor protein movement between mitochondrial subpopulations

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics

The ERMES (ER-mitochondria encounter structure) complex shows a remarkable separation pattern in proteome profiling, with three subunits (Mdm10, Mdm34, and Gem1) anchored in the mitochondrial outer membrane and two (Mmm1 and Mdm12) located at the ER membrane or cytosolic side. This distribution pattern provides a valuable framework for understanding how AIM11 might interact with mitochondrial tethering complexes .

How can researchers differentiate between direct and indirect effects of AIM11 on mitochondrial function?

Differentiating between direct and indirect effects of AIM11 on mitochondrial function requires a systematic approach combining genetic, biochemical, and temporal analyses:

  • Acute vs. chronic depletion comparison:

    • Implement an auxin-inducible degron system for rapid AIM11 protein depletion

    • Compare immediate effects (likely direct) with long-term consequences (potentially indirect)

    • Monitor time-course of phenotypic changes following AIM11 depletion

  • Structure-function analysis:

    • Create a library of point mutations or truncations in functional domains

    • Express these variants in the AIM11 deletion background

    • Correlate specific mutations with discrete phenotypic effects

    • Use alanine scanning mutagenesis for systematic functional mapping

  • Rescue experiments:

    • Express orthologs from related species to identify conserved functions

    • Create chimeric proteins with domains from other mitochondrial proteins

    • Perform domain swapping to map critical functional regions

  • Direct biochemical assays:

    • Develop in vitro reconstitution systems using purified components

    • Test direct effects on membrane properties, protein activities, or mtDNA maintenance

    • Use liposome-based assays to test effects on membrane dynamics

  • Epistasis analysis:

    • Construct double mutants with genes in related pathways

    • Analyze phenotypes to determine genetic relationships (suppression, enhancement, epistasis)

    • Map AIM11 within functional pathways through genetic interaction networks

This multi-faceted approach allows researchers to build a comprehensive understanding of direct AIM11 functions while distinguishing secondary consequences of its absence.

What techniques can reveal the dynamic behavior of AIM11 during mitochondrial division and inheritance?

Revealing the dynamic behavior of AIM11 during mitochondrial division and inheritance requires sophisticated live-cell imaging techniques combined with genetic and biochemical approaches:

  • Advanced live-cell imaging:

    • 4D confocal microscopy (x, y, z, time) with deconvolution

    • Lattice light-sheet microscopy for higher resolution with reduced phototoxicity

    • Dual-color imaging with markers for mitochondrial division (e.g., Dnm1/Drp1)

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • FLIP (Fluorescence Loss In Photobleaching) to assess compartmentalization

    • Single-molecule tracking with photoactivatable fluorescent proteins

  • Correlative light and electron microscopy (CLEM):

    • Capture live dynamics with fluorescence microscopy

    • Fix cells at critical time points

    • Process for electron microscopy to visualize ultrastructure

    • Correlate dynamic events with structural changes

  • Optogenetic tools:

    • Develop light-inducible AIM11 oligomerization or inactivation systems

    • Trigger AIM11 function changes at precise time points during division

    • Monitor immediate consequences on mitochondrial dynamics

  • Biosensors for local environment:

    • Create AIM11 fusion constructs with environment-sensitive fluorophores

    • Monitor local pH, calcium, or membrane potential changes

    • Correlate environmental changes with protein behavior

  • Quantitative analysis:

    • Develop computational tools for tracking mitochondrial movement patterns

    • Analyze colocalization coefficients with division/inheritance markers

    • Implement machine learning approaches for pattern recognition in dynamic behavior

These methodologies provide complementary insights into AIM11's temporal and spatial dynamics during the complex processes of mitochondrial division and inheritance.

How does AIM11 interact with other mitochondrial proteins in maintaining organelle integrity?

Understanding AIM11's interactions with the mitochondrial protein network requires integration of multiple protein interaction discovery and validation methods:

  • Comprehensive interaction mapping:

    • SILAC-based quantitative affinity purification-mass spectrometry (q-AP-MS) to identify stable interactors

    • BioID or APEX2 proximity labeling to capture transient or weak interactions

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

    • Membrane yeast two-hybrid (MYTH) system for membrane protein interactions

  • Validation of key interactions:

    • Co-immunoprecipitation with reciprocal pull-downs

    • Bimolecular Fluorescence Complementation (BiFC) for in vivo confirmation

    • Förster Resonance Energy Transfer (FRET) for quantifying interaction strength

    • Blue Native PAGE to identify native protein complexes containing AIM11

  • Functional relationship assessment:

    • Genetic interaction mapping through synthetic genetic array (SGA) analysis

    • Phenotypic comparison of single and double mutants

    • Suppressor screening to identify genes that rescue AIM11 deletion phenotypes

  • Structural studies:

    • Cryo-EM analysis of AIM11-containing complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding interfaces

    • In silico modeling of interaction networks based on experimental data

Research on mitochondrial proteomes has established methods for delineating functional protein interaction networks using SILAC-based q-AP-MS approaches. This technique has successfully mapped interactions for components of complexes like TOM, TIM23-PAM, and MICOS, providing a methodological framework for studying AIM11 interactions .

How might AIM11 function contribute to azole resistance mechanisms in C. tropicalis?

The potential contribution of AIM11 to azole resistance in C. tropicalis involves several mechanistic pathways that researchers should investigate:

  • Mitochondrial stress response and adaptation:

    • AIM11 may modulate mitochondrial function under azole stress

    • Altered mitochondrial activity can trigger compensatory metabolic pathways

    • Metabolic flexibility provided by functional mitochondria may support survival during azole treatment

  • Interaction with established resistance mechanisms:

    • Potential influence on ERG11 expression or stability

    • AIM11 deletion/overexpression effects on expression of resistance genes (ERG11, CDR1, MDR1)

    • Mitochondrial function impacts on ergosterol biosynthesis, the target pathway of azoles

  • Stress signaling pathways:

    • Role in retrograde signaling from mitochondria to nucleus

    • Influence on stress-responsive transcription factors

    • Contribution to general stress adaptation mechanisms

  • Biofilm formation influence:

    • Mitochondrial function impacts on biofilm development

    • Connection between biofilm formation and drug resistance

    • Role in persister cell formation within biofilms

Investigating these pathways requires examining azole resistance profiles in AIM11 mutants compared to wild-type strains. Research on clinical C. tropicalis isolates has shown that mutations in the ERG11 gene (particularly Y132F, Y257N, and S154F) are predominant resistance mechanisms, while expression of efflux pumps (MDR1, CDR1) can vary between susceptible and resistant isolates . Determining how AIM11 interacts with these established mechanisms would provide valuable insights into resistance development.

What role might AIM11 play in biofilm formation and virulence of C. tropicalis?

AIM11's potential role in biofilm formation and virulence requires investigation through several complementary approaches:

  • Biofilm characteristics assessment:

    • Quantify biofilm formation in wild-type vs. AIM11 deletion strains

    • Evaluate biofilm architecture using confocal microscopy

    • Analyze extracellular matrix composition

    • Test biofilm resistance to antifungals and stress conditions

  • Virulence factor production:

    • Measure secreted hydrolytic enzymes (proteinases, phospholipases, hemolysins)

    • Assess adhesion capabilities to epithelial and endothelial cells

    • Evaluate hyphae formation under inducing conditions

    • Examine phenotypic switching frequency

  • Host-pathogen interaction studies:

    • Co-culture with immune cells to assess phagocytosis resistance

    • Measure cytokine responses from host cells

    • Evaluate persistence in ex vivo tissue models

    • Test tissue invasion capabilities

  • Metabolic adaptation during infection:

    • Analyze metabolic profiles in infection-mimicking conditions

    • Assess flexibility in energy production pathways

    • Measure stress resistance during host-mimicking challenges

C. tropicalis is recognized as a strong biofilm producer, often surpassing C. albicans in this capacity . Clinical isolates consistently show moderate to strong biofilm production capabilities . Given that mitochondrial function is linked to stress adaptation and energy production, AIM11 may influence biofilm formation through metabolic regulation and stress response pathways. The osmotolerance of C. tropicalis may also be connected to mitochondrial adaptation mechanisms that could involve AIM11 .

How can understanding AIM11 function help develop new antifungal strategies against C. tropicalis?

Understanding AIM11 function can inform novel antifungal strategies through several research pathways:

  • Vulnerability assessment:

    • Determine if AIM11 deletion creates specific vulnerabilities to existing drugs

    • Screen compound libraries for synthetic lethality with AIM11 deletion

    • Identify cellular processes that become essential in the absence of AIM11

  • Combination therapy development:

    • Test synergistic effects between mitochondrial-targeting compounds and traditional antifungals

    • Evaluate whether inhibiting AIM11 function sensitizes resistant strains to azoles

    • Develop dual-targeting approaches addressing both AIM11 function and established resistance mechanisms

  • Biofilm disruption strategies:

    • If AIM11 contributes to biofilm integrity, develop approaches targeting this aspect

    • Design compounds that penetrate biofilms by exploiting AIM11-related pathways

    • Create biofilm-dispersal agents based on AIM11 function

  • Virulence attenuation approaches:

    • Develop compounds that inhibit AIM11 function without killing cells

    • Target virulence rather than growth to reduce selection pressure

    • Design narrow-spectrum agents specific to C. tropicalis AIM11

  • Host-directed therapeutic strategies:

    • Understand how host cells interact with C. tropicalis mitochondria

    • Develop approaches to enhance host detection of fungal cells

    • Augment host defense mechanisms against C. tropicalis mitochondrial proteins

The increasing prevalence of azole resistance in C. tropicalis clinical isolates, with MIC values ranging from 8 to >64 mg/L for fluconazole and 0.25 to 1 mg/L for voriconazole, underscores the urgent need for alternative therapeutic strategies . Targeting mitochondrial proteins like AIM11 represents a promising avenue, particularly if these targets differ sufficiently from host counterparts or affect pathogen-specific processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.