Recombinant Candida tropicalis Cytochrome b5 (Cytb5)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Candida tropicalis Cytochrome b5 (Cytb5)

Recombinant Candida tropicalis Cytochrome b5 (Cytb5) refers to a genetically engineered form of the Cytb5 protein, originally derived from the yeast species Candida tropicalis . Cytb5 is a hemoprotein involved in various electron transfer reactions within the cell . The recombinant form is produced by introducing the Cytb5 gene from C. tropicalis into a host organism, such as Escherichia coli, where it is expressed to generate large quantities of the protein . The purpose of producing recombinant Cytb5 is typically for research, industrial, or pharmaceutical applications .

Gene and Protein Information

The cytochrome b5 gene from Candida tropicalis (CYTb5) can be isolated and manipulated to enhance its expression . Techniques such as modifying existing promoters, isolating alternative promoters, or using strong promoters from Candida β-oxidation genes (e.g., POX4 and POX5) can increase CYTb5 gene expression . The strength of the promoter can be measured using quantitative competitive reverse transcription polymerase chain reaction (QC-RT-PCR) to measure CYTb5 gene expression in yeast cells .

Production and Expression

To produce recombinant Cytb5, the CYTb5 gene is introduced into host cells using techniques known in the art . Suitable host cells include prokaryotes such as Bacillus sp., Pseudomonas sp., Actinomycetes sp., Escherichia sp., Mycobacterium sp., and eukaryotes such as yeast, algae, insect cells, plant cells, and filamentous fungi . Yeast cells, particularly those of the Candida genus, are often preferred . The C. tropicalis Cytb5 protein with a His-tag can be expressed in E. coli .

Function and Applications

Cytochrome b5 is involved in several biological processes, including the detoxification of xenobiotic compounds and the biosynthesis and metabolism of lipids and secondary metabolites . It plays a crucial role in electron transfer to desaturases and hydroxylases, which are involved in the biosynthesis of unsaturated fatty acids, sphingolipids, and sterols .

ApplicationDescription
Improving Diacid ProductivitySelective integration, amplification, and overexpression of the CYTb5 gene in C. tropicalis can enhance diacid productivity .
Research PurposesRecombinant Cytb5 is used in site-directed mutagenesis studies to understand its structure, function, and membrane topology . It is also used to study its interactions with redox partners .
Industrial ApplicationsEnhanced expression of the CYTb5 gene can be used to construct new and improved production strains of Candida for various bioconversion processes .

Site-Directed Mutagenesis Studies

Site-directed mutagenesis studies have provided insights into the structure and function of cytochrome b5 . These studies have shown that the membrane-binding domain of cytochrome b5 spans the bilayer, and specific amino acids in the membrane-binding domain are not essential for the function of cytochrome b5 with its redox partners .

Role in Fatty Acid Metabolism

In Candida tropicalis, Cytb5 plays a significant role in the catabolism of fatty acids through the cyclic β-oxidation pathway . The expression of the CYTb5 gene and its induction by alkanes or fatty acids can be measured using QC-RT-PCR assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cytb5; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Candida tropicalis (Yeast)
Target Names
Cytb5
Target Protein Sequence
MTDTDTTTTIYTHEEVAQHTTHDDLWVILNGKVYNISNYIDEHPGGEEVILDCAGTDATE AFDDIGHSDEAHEILEKLYIGNLKGAKIVEAKHAQSFSTEEDSGINFPLIAVGVFLAAFG VYYYKTNFA
Uniprot No.

Target Background

Function
Membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases.
Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is the biological function of Cytochrome b5 in Candida tropicalis?

Cytochrome b5 in Candida tropicalis serves as an electron transfer protein in multiple metabolic pathways. It functions as part of the electron transport system that can support cytochrome P450-mediated reactions, particularly in fatty acid metabolism . In C. tropicalis grown on alkane, it plays a role in the oxidation pathway . The protein exhibits autooxidizable properties and presents different midpoint potential values depending on the purification method used: 35 ± 5 mV for cholate solubilization, -59 ± 5 mV for trypsin treatment, and -65 ± 5 mV for osmotic wash .

How does Cytochrome b5 interact with NADH Cytochrome b5 reductase in Candida species?

Cytochrome b5 works in coordination with NADH cytochrome b5 reductase as part of an electron transport system. In Candida species, this system can efficiently support cytochrome P450-mediated reactions by providing both the first and second electrons required in the catalytic cycle . This is particularly important because it represents an alternative electron donation pathway to the traditional NADPH cytochrome P450 reductase (CPR) system. Studies have shown that in fungal CYP51-mediated sterol 14α-demethylation, the cytochrome b5/NADH cytochrome b5 reductase electron transport system can wholly and efficiently support the reaction . This alternative pathway explains the continued ergosterol production observed in yeast strains with disrupted CPR genes .

What are the optimal expression conditions for producing recombinant Candida tropicalis Cytochrome b5 in E. coli?

For optimal expression of recombinant C. tropicalis Cytochrome b5 in E. coli, researchers should consider:

  • Vector selection: Expression vectors like pJF118EH have been successfully used for Candida genes .

  • E. coli strain: BL21(DE3) or similar strains designed for protein expression are recommended.

  • Induction conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • IPTG concentration: 0.1-0.5 mM is typically effective

    • Induction time: 4-16 hours

For PCR amplification of the Cytb5 gene, design primers with appropriate restriction sites (such as EcoRI and BamHI) to facilitate cloning into expression vectors . The sequence should include the ATG initiation codon in the forward primer and termination codons in the reverse primer . After expression, purification can be achieved using affinity chromatography if a tag (such as His-tag) is incorporated .

How do different solubilization methods affect the properties of purified Cytochrome b5 from Candida tropicalis?

Different solubilization methods significantly impact the molecular weight and redox properties of the purified protein:

Solubilization MethodMolecular Weight (Da)Midpoint Potential (mV)Optical PropertiesStability
Sodium Cholate16,000 ± 1,00035 ± 5IdenticalStable to temperature and pH
Trypsin Treatment12,000 ± 1,000-59 ± 5IdenticalStable to temperature and pH
Osmotic Wash12,000 ± 1,000-65 ± 5IdenticalStable to temperature and pH

Despite differences in molecular weight and midpoint potential, all forms maintain similar optical characteristics and stability profiles . The choice of solubilization method should be based on the intended application - sodium cholate provides a more intact protein with a higher midpoint potential, while trypsin treatment likely removes the membrane-anchoring domain but results in a more negative redox potential.

What experimental approaches can be used to study the interaction between Cytochrome b5 and P450 enzymes in Candida tropicalis?

To investigate the interaction between Cytochrome b5 and P450 enzymes in C. tropicalis:

  • Reconstitution assays: Combine purified recombinant Cytochrome b5, P450 enzyme, and NADH cytochrome b5 reductase in a defined lipid environment to measure electron transfer efficiency and enzyme activity .

  • Spectroscopic methods:

    • UV-visible spectroscopy to monitor redox state changes

    • Stopped-flow techniques to measure electron transfer kinetics

    • Circular dichroism to assess protein-protein interaction effects on structure

  • Protein-protein interaction studies:

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Cross-linking followed by mass spectrometry to identify interaction sites

  • Functional assays: Measure P450 activity (such as sterol 14α-demethylation) with and without Cytochrome b5 to quantify the enhancement effect .

When interpreting results, researchers should account for the approximately 30% uncoupling that occurs during reactions with cytochrome c, as observed with related systems .

How can researchers distinguish between type I and type II uncoupling in Cytochrome b5/P450 electron transfer systems?

Distinguishing between type I and type II uncoupling in Cytochrome b5/P450 electron transfer systems requires systematic analysis:

  • Type I uncoupling (autooxidation of oxygen-bound P450):

    • Measure hydrogen peroxide formation using fluorescent probes (Amplex Red)

    • Quantify using the stoichiometry of NADH consumption versus product formation

    • Typically occurs before product formation steps

  • Type II uncoupling (peroxide shunt pathway):

    • Monitor superoxide formation using cytochrome c reduction assays

    • Use superoxide dismutase inhibition to confirm specificity

    • Typically occurs during the second electron transfer

For accurate assessment, researchers should measure total reactive oxygen species (ROS) production under varying conditions (pH, ionic strength, temperature) to establish a baseline. According to studies with related systems, approximately 30% uncoupling occurs during reactions with cytochrome c, and this uncoupling is not significantly influenced by different physicochemical conditions .

Data interpretation should consider that in Candida-derived systems, the electron transfer from Cytochrome b5 can occur directly to P450 enzymes without requiring the traditional NADPH cytochrome P450 reductase intermediate .

What are the challenges in analyzing redox potential differences in Cytochrome b5 variants purified through different methods?

Analyzing redox potential differences in Cytochrome b5 variants requires addressing several methodological challenges:

  • Reference electrode calibration: Ensure consistent reference electrodes for comparing across studies. Small calibration errors can significantly impact midpoint potential values.

  • Buffer composition effects: Redox potentials of heme proteins are sensitive to:

    • Ionic strength (use consistent buffer conditions)

    • pH (maintain at physiological pH 7.0-7.4)

    • Temperature (conduct measurements at 25°C standard)

  • Data analysis approaches:

    • Use the Nernst equation with proper n-value determination

    • Apply multiple titration techniques (spectrochemical and potentiometric)

    • Perform statistical analysis on replicate measurements (minimum n=3)

When comparing Cytochrome b5 variants from C. tropicalis, consider that sodium cholate-solubilized protein shows a midpoint potential of 35 ± 5 mV, while trypsin-treated and osmotically-washed variants exhibit values of -59 ± 5 mV and -65 ± 5 mV, respectively . These differences likely reflect structural changes rather than experimental artifacts, as optical properties remain consistent across variants.

How can researchers utilize Candida tropicalis Cytochrome b5 in heterologous expression systems for studying P450-mediated reactions?

For heterologous expression studies involving C. tropicalis Cytochrome b5:

  • Co-expression strategies:

    • Design a dual-expression vector containing both Cytochrome b5 and the target P450

    • Use compatible vectors with different selection markers

    • Consider inserting the pox4 promoter to enhance expression in Candida systems

  • Expression host selection:

    • E. coli: Simplest system but lacks post-translational modifications

    • S. cerevisiae: Better for studying eukaryotic interactions

    • C. tropicalis itself: Ideal for native interactions but more challenging genetically

  • Functional assessment methods:

    • Measure substrate conversion rates of P450 enzymes

    • Compare systems with and without Cytochrome b5

    • Evaluate ROS generation to assess uncoupling

Studies have shown that when heterologously expressing CPR genes from C. tropicalis in S. cerevisiae cpr mutants, high CPR activities were observed, and the mutants showed complementation of ketoconazole sensitivity . This suggests that heterologous systems can successfully reconstitute functional electron transfer pathways.

What role does Cytochrome b5 play in the fatty acid metabolism of Candida tropicalis, and how can this be experimentally validated?

Cytochrome b5 plays a crucial role in fatty acid metabolism in C. tropicalis, particularly in the omega-oxidation pathway:

  • Role in electron transfer:

    • Provides electrons to cytochrome P450 enzymes involved in fatty acid hydroxylation

    • Supports the conversion of fatty acids to dicarboxylic acids

    • Facilitates electron flow in fatty alcohol oxidation

  • Experimental validation approaches:

    • Gene knockout/knockdown studies to assess impact on fatty acid metabolism

    • Metabolomic analysis to track changes in fatty acid metabolites

    • Growth studies on fatty acid substrates as sole carbon sources

    • In vitro reconstitution of the pathway with purified components

  • Specific methodologies:

    • Create Cytb5 deletion mutants using CRISPR-Cas9 or traditional disruption methods

    • Analyze growth phenotypes on media with different alkanes or fatty acids

    • Quantify dicarboxylic acid production using GC-MS or HPLC

C. tropicalis is known to convert fatty acids to long-chain dicarboxylic acids via a pathway that includes the oxidation of fatty alcohols . The role of Cytochrome b5 in this pathway can be confirmed by comparing wild-type and Cytb5-deficient strains for their ability to grow on and metabolize alkanes and fatty acids.

How does the structure of Candida tropicalis Cytochrome b5 compare to homologs from other species, and what are the implications for electron transfer efficiency?

Comparison of C. tropicalis Cytochrome b5 with homologs from other species reveals structural insights with implications for electron transfer:

  • Structural conservation and divergence:

    • The core domain containing the heme-binding region is highly conserved

    • The membrane-anchoring C-terminal region shows greater variability

    • Species-specific amino acid substitutions occur primarily in surface-exposed regions

  • Functional implications:

    • Species-specific variations may optimize interactions with partner proteins

    • Different redox potentials across species correlate with metabolic adaptations

    • Membrane association properties affect localization and accessibility

  • Experimental approaches for comparative analysis:

    • Homology modeling based on crystal structures from related species

    • Site-directed mutagenesis to introduce cross-species variations

    • Electron transfer kinetics measurements using stopped-flow spectroscopy

The unique properties of C. tropicalis Cytochrome b5, including its ability to function with NADH cytochrome b5 reductase to fully support P450 reactions, suggest adaptations that might be particularly valuable for biotechnological applications . This contrasts with some mammalian systems where Cytochrome b5 typically provides only the second electron in the P450 cycle.

What are common challenges in purifying active recombinant Candida tropicalis Cytochrome b5, and how can they be addressed?

Common challenges and solutions for purifying active recombinant C. tropicalis Cytochrome b5:

  • Inclusion body formation:

    • Lower induction temperature to 16-20°C

    • Reduce IPTG concentration to 0.1-0.2 mM

    • Add 2-5% glycerol to growth medium

    • Consider fusion tags that enhance solubility (SUMO, MBP)

  • Improper heme incorporation:

    • Supplement expression medium with δ-aminolevulinic acid (0.5 mM)

    • Add hemin (5-10 μM) to the culture during induction

    • Consider co-expression with heme synthesis enzymes

  • Protein instability during purification:

    • Include protease inhibitors in all buffers

    • Maintain reducing conditions (1-5 mM DTT or 2-mercaptoethanol)

    • Keep samples cold (4°C) throughout purification

    • Add glycerol (10-20%) to storage buffers

  • Purification strategy optimization:

    • For His-tagged protein: Use Ni-NTA chromatography with imidazole gradient elution

    • For untagged protein: Follow established procedure of DEAE-cellulose chromatography, hydroxylapatite chromatography, second DEAE-cellulose chromatography, and Sephadex G-75 gel filtration

    • Consider buffer composition: Tris/PBS-based buffers (pH 8.0) with 6% trehalose work well for storage

  • Storage stability:

    • Lyophilize or store at -20°C/-80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • Add cryoprotectants (50% glycerol recommended)

How can researchers accurately assess the functional activity of recombinant Cytochrome b5 in vitro?

To accurately assess the functional activity of recombinant Cytochrome b5:

  • Spectroscopic characterization:

    • UV-visible spectroscopy to confirm proper heme incorporation (characteristic peaks at ~413 nm oxidized, ~423 nm reduced)

    • Reduced minus oxidized difference spectra to verify functional heme center

    • Ensure protein concentration determination accounts for heme contribution

  • Electron transfer assays:

    • Cytochrome c reduction assay: Monitor absorbance increase at 550 nm

    • Ferricyanide reduction: Measure decrease in absorbance at 420 nm

    • P450 reduction: Follow spectral shifts characteristic of P450 reduction

  • Reconstitution systems:

    • Combine with NADH cytochrome b5 reductase for complete electron transfer chain

    • Include appropriate P450 enzyme for functional endpoint assays

    • Use defined phospholipid vesicles or nanodiscs for membrane protein reconstitution

  • Data analysis considerations:

    • Calculate electron transfer rates based on extinction coefficients

    • Consider temperature and pH effects on activity

    • Account for uncoupling (~30% with cytochrome c)

    • Compare to benchmark standards (mammalian Cytochrome b5)

These approaches provide complementary information, and researchers should use multiple methods to thoroughly characterize the functional properties of recombinant Cytochrome b5.

What techniques can be used to study the membrane association properties of Candida tropicalis Cytochrome b5?

To investigate membrane association properties of C. tropicalis Cytochrome b5:

  • Membrane fractionation studies:

    • Differential centrifugation to separate microsomes from cytosol

    • Sucrose density gradient centrifugation for refined membrane separation

    • Western blotting with anti-Cytochrome b5 antibodies to track localization

  • Protein-lipid interaction analyses:

    • Liposome binding assays with varying lipid compositions

    • Monolayer surface pressure measurements

    • Detergent resistance profiling to assess membrane domain association

  • Structural characterization of membrane interactions:

    • Tryptophan fluorescence to monitor membrane insertion

    • Circular dichroism to detect secondary structure changes upon membrane binding

    • Limited proteolysis accessibility to identify protected regions

  • Molecular dynamics approaches:

    • Simulation of protein-membrane interactions

    • Free energy calculations for membrane insertion

    • Identification of key residues involved in lipid interactions

  • Microscopy techniques:

    • Immunofluorescence microscopy of GFP-tagged Cytochrome b5

    • Super-resolution microscopy to visualize membrane distribution

    • FRET-based analyses to study protein-protein interactions in membranes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.