Recombinant Candida tropicalis Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Overview of FCJ1

FCJ1, also known as MIC60 or mitofilin, is a mitochondrial inner membrane protein specifically enriched in crista junctions (CJs) . FCJ1 is involved in determining the number and architecture of CJs . The protein is found in Candida tropicalis and Saccharomyces cerevisiae .

Structure and Properties

Recombinant FCJ1 is a full-length protein consisting of 542 amino acids . It has a molecular weight of approximately 62.5 kDa . The recombinant protein is expressed in E. coli and contains an N-terminal His tag for purification purposes . The protein is provided as a lyophilized powder and should be stored at -20°C or -80°C upon receipt . Repeated freezing and thawing cycles should be avoided .

Function and Mechanism

FCJ1 is essential for the formation of crista junctions, which are critical for mitochondrial structure and function . Studies have shown that cells lacking FCJ1 exhibit a lack of CJs and display concentric stacks of inner membrane in the mitochondrial matrix . Overexpression of FCJ1 leads to an increase in CJ formation, branching of cristae, and enlargement of CJ diameter .

FCJ1 interacts functionally with Su e/Su g in an antagonistic mode that appears crucial for the formation of CJs . The C-terminal domain of Fcj1 is crucial for the formation of stable CJs and is required for the genetic interaction of FCJ1 with the F1FO ATP synthase .

Research Findings

  • Localization of FCJ1: Immuno-electron microscopy studies have shown that FCJ1 is prominently clustered in close proximity to the CJ .

  • Role in Cristae Morphology: Overexpression and down-regulation of FCJ1 directly affect the number of CJs and cristae branches .

  • Interaction with ATP Synthase: FCJ1 interacts with the F1FO-ATP synthase, influencing its oligomeric state and affecting cristae morphology .

  • Genetic Interactions: Genetic studies have revealed interactions between FCJ1 and subunits of the F1FO-ATP synthase, particularly Su e and Su g .

  • Cristae Tip Abundance: Cristae tips per mitochondrial section were found to be 2.5-fold more abundant in sections of fcj1 cells than in wild type .

Tables

Table 1: Effects of FCJ1 Overexpression on Cristae Morphology

FeatureWild-Type CellsFCJ1 Overexpression
CJs per cellBaselineIncreased 2-3 fold
Cristae branchingRareIncreased ~17-fold
CJ diameterNormalEnlarged, higher variation

Table 2: Doubling Times of Deletion Strains on Non-Fermentable Carbon Source

StrainDoubling Time (Relative to Wild Type)
Wild Type1.0x
Δfcj1~1.75x longer
Δfcj1/Δsu eSignificantly shorter than Δfcj1
Δfcj1/Δsu gSignificantly shorter than Δfcj1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its implementation during production.
Synonyms
MIC60; CTRG_00745; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-567
Protein Length
Full Length of Mature Protein
Species
Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)
Target Names
MIC60
Target Protein Sequence
NTTQKVVVTPPPVATEGELPPPQPKVTPPKATPPPPPKTKRFSLFGFLLKTTLLASVVYG GTLYAATKNDKVMDFVVDNRLPYHEELLELIETGSIDDLQQGLDQLKSKFGSVKLPSKEE IDELAQKLEHKGEDIIKETKKKFTATRTGTDLTPSEQLQKGVEIESVKKDVPHLPLIELN SELGSSVDETVKQTIASFNNFIQTIDASTLASKNDKLIASINFSISQLASKLNGLTKSFD EELQKKLKVSQTELFSSFTKKELELTENLLHQFTTEKQQLEAKLNEKLNQEIQASRTAIS QAATNAVSMVRIEQTKNFEKLVTEKLNEERNGRLANLDKLNDRLTELEKFAEGFETQIVS NHKKALIQQAVSKLKSLLLAPAANEKPKSIKPYVDELSKIAADDEVLKLALKDLTPLLSN ESTHSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGVKQDGKD IESVIGRVESSLARGELDVAVEEAANLKGWSRKLANDWVVEGRKRLEVEFLLGLIESESK II
Uniprot No.

Target Background

Function
Recombinant *Candida tropicalis* Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located in the inner mitochondrial membrane, plays vital roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating the formation of contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane and promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is FCJ1 protein and what is its primary function in mitochondria?

FCJ1 (Formation of Crista Junctions protein 1) is a mitochondrial membrane protein specifically enriched at crista junctions (CJs), which are tubular invaginations of the inner mitochondrial membrane that connect the inner boundary membrane with the cristae membrane. FCJ1 is essential for the formation and maintenance of these architectural elements, which are critical for proper mitochondrial function. In the absence of FCJ1, cells lack CJs and exhibit abnormal mitochondrial morphology, including concentric stacks of inner membrane within the mitochondrial matrix . In Candida tropicalis specifically, FCJ1 (UniProt ID: C5M3V6) is also known as MIC60 or mitofilin and functions as a subunit of the MICOS complex, which is determinant for mitochondrial inner membrane architecture .

What is the domain structure of FCJ1 and which domains are critical for its function?

FCJ1 contains multiple functional domains, with the C-terminal domain being the most conserved and essential for its function. The full-length mature Candida tropicalis FCJ1 protein spans amino acids 26-567 and contains regions responsible for membrane association and protein-protein interactions . Studies have shown that the C-terminal domain is particularly crucial for FCJ1 function, as it:

  • Interacts with full-length FCJ1, suggesting a role in oligomer formation

  • Interacts with the TOB/SAM complex (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery)

  • Is required for proper formation of crista junctions

When the C-terminal domain is absent, crista junction formation is strongly impaired, resulting in irregular and stacked cristae membranes . This demonstrates that the C-terminal region is indispensable for the architectural role of FCJ1 in mitochondria.

How does FCJ1 relate to the MICOS complex, and what is the significance of this relationship?

FCJ1 is a key component of the mitochondrial contact site (MICOS) complex, which is essential for the formation of contact sites between the outer and inner mitochondrial membranes. The MICOS complex is preferentially located at crista junctions and forms a superstructure that links the inner boundary membrane to the cristae. Mass spectrometry analysis has identified FCJ1 as part of this complex, which consists of at least six different mitochondrial membrane proteins that physically interact with each other .

The significance of FCJ1's role in the MICOS complex is substantial, as loss of MICOS subunits results in:

  • Complete disappearance or impairment of crista junctions

  • Loss of respiratory competence

  • Altered inheritance of mitochondrial DNA

  • Disruption of the mitochondrial inner membrane architecture

This indicates that FCJ1, as part of the MICOS complex, is essential for maintaining proper mitochondrial structure and function, which in turn affects cellular bioenergetics and mitochondrial genome inheritance .

What are the recommended methods for isolating and purifying recombinant Candida tropicalis FCJ1 protein?

For isolation and purification of recombinant Candida tropicalis FCJ1 protein, the following methodological approach is recommended:

  • Expression system: Express the full-length mature protein (amino acids 26-567) in E. coli with an N-terminal His-tag for optimal functionality. C-terminal tagging may interfere with protein interactions, as the C-terminal domain is critical for FCJ1's interactions with other MICOS components .

  • Purification protocol:

    • Use affinity chromatography with Ni-NTA resin to capture the His-tagged protein

    • Follow with size exclusion chromatography to separate oligomeric states and remove aggregates

    • For higher purity, consider ion exchange chromatography as an additional step

  • Buffer optimization: Use Tris-based buffers (pH 8.0) with stabilizing agents such as trehalose (6%) to maintain protein stability during purification and storage .

  • Storage considerations: After purification, store the protein as a lyophilized powder or in storage buffer with 50% glycerol at -20°C/-80°C. Avoid repeated freeze-thaw cycles by preparing working aliquots that can be stored at 4°C for up to one week .

For reconstitution prior to experimental use, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage stability .

What experimental approaches can be used to study FCJ1's role in crista junction formation?

To investigate FCJ1's role in crista junction formation, researchers can employ several complementary experimental approaches:

  • Deletion and overexpression studies:

    • Generate FCJ1 deletion strains (Δfcj1) to observe the complete loss of crista junctions and the formation of concentric inner membrane stacks

    • Create overexpression models to observe increased CJ formation, branching of cristae, and enlargement of CJ diameter

    • These opposing phenotypes provide strong evidence for FCJ1's direct role in CJ architecture

  • Electron microscopy analysis:

    • Transmission electron microscopy (TEM) to visualize mitochondrial ultrastructure

    • Electron tomography for 3D reconstruction of crista junctions

    • Quantitative analysis of CJ number, diameter, and distribution

  • Domain-specific mutational analysis:

    • Create truncated versions of FCJ1 lacking specific domains (particularly the C-terminal domain)

    • Generate point mutations in conserved residues

    • Assess the impact on CJ formation and protein-protein interactions

  • FRET or BiFC analysis to study in vivo interactions between FCJ1 and other MICOS components or the TOB/SAM complex

  • Subcellular fractionation combined with quantitative high-resolution mass spectrometry to determine the precise localization of FCJ1 within mitochondrial subcompartments

These approaches collectively provide comprehensive insights into how FCJ1 contributes to crista junction formation and maintenance.

What controls should be included when studying recombinant FCJ1 protein function in vitro?

When studying recombinant FCJ1 protein function in vitro, several critical controls should be included to ensure experimental validity:

  • Protein quality controls:

    • Verify protein purity by SDS-PAGE (>90% purity recommended)

    • Confirm proper folding using circular dichroism or limited proteolysis

    • Assess oligomeric state using size exclusion chromatography or native PAGE

    • Verify His-tag accessibility and functionality through Western blotting

  • Functional controls:

    • Include denatured FCJ1 protein as a negative control

    • Test truncated FCJ1 versions (particularly lacking the C-terminal domain) to validate domain-specific functions

    • Compare N-terminally tagged versus C-terminally tagged FCJ1, as C-terminal tagging may impair interactions with other MICOS components

  • Specificity controls:

    • Include other mitochondrial proteins not involved in crista junction formation

    • Test FCJ1 homologs from other species (e.g., yeast mitofilin) to determine conserved functional properties

    • Use binding partners with known mutations that disrupt interaction with FCJ1

  • System validation:

    • Reconstitute minimal systems with purified interaction partners (e.g., TOB/SAM complex components)

    • Perform rescue experiments in FCJ1-depleted systems to confirm functional complementation

    • Use liposome-based assays to test membrane-shaping properties in a controlled environment

These controls collectively help distinguish specific FCJ1 functions from non-specific effects and validate the physiological relevance of in vitro observations.

How does FCJ1 interact with the TOB/SAM complex, and what is the functional significance of this interaction?

FCJ1 interacts with the TOB/SAM (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery) complex through its conserved C-terminal domain. Specifically, the C-terminal domain of FCJ1 has been shown to interact with Tob55, a core component of the TOB/SAM complex, which is required for the insertion of β-barrel proteins into the mitochondrial outer membrane .

The functional significance of this interaction includes:

  • Stabilization of crista junctions: The FCJ1-TOB/SAM interaction helps stabilize crista junctions in close proximity to the outer membrane, establishing a physical link between inner membrane structures and outer membrane complexes.

  • Formation of contact sites: This interaction contributes to the formation of contact sites between the inner and outer mitochondrial membranes, which are important for various mitochondrial functions.

  • Membrane architecture regulation: When the TOB/SAM complex is down-regulated, alterations in cristae morphology and a moderate reduction in the number of crista junctions are observed, suggesting that this interaction plays a role in maintaining proper inner membrane architecture.

Importantly, while FCJ1 interacts with the TOB/SAM complex, the biogenesis of β-barrel proteins (the primary function of TOB/SAM) is not significantly affected in the absence of FCJ1. This suggests that the interaction is more critical for inner membrane architecture than for the protein import function of TOB/SAM .

What is the relationship between FCJ1 and F1FO-ATP synthase supercomplexes in mitochondria?

FCJ1 and F1FO-ATP synthase (F1FO) have an antagonistic relationship that plays a crucial role in determining cristae morphology:

The current model suggests that the local antagonism between FCJ1 and Su e/g modulates the F1FO oligomeric state, thereby controlling membrane curvature to generate both crista junctions and cristae tips .

What methods can be used to identify and validate novel FCJ1 interaction partners?

Several complementary approaches can be employed to identify and validate novel FCJ1 interaction partners:

  • Proximity-based labeling:

    • BioID or APEX2 fusion proteins to identify proximal proteins in vivo

    • These methods allow for identification of transient or weak interactions in the native cellular environment

    • Particularly valuable for membrane proteins like FCJ1 that exist in complex assemblies

  • Affinity purification-mass spectrometry (AP-MS):

    • Use N-terminally His-tagged FCJ1 for co-isolation experiments (C-terminal tagging has been shown to weaken interactions)

    • Cross-validation using reciprocal tagging of candidate interaction partners

    • Quantitative SILAC-based approaches to distinguish true interactors from background

  • Molecular sizing experiments:

    • Size exclusion chromatography combined with Western blotting to detect co-elution of FCJ1 with potential interaction partners

    • Blue native PAGE to analyze intact complexes

    • Gradient ultracentrifugation to separate complexes based on size and density

  • Direct binding assays:

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) using purified recombinant proteins

    • Pull-down assays with domain-specific constructs to map interaction interfaces

    • Yeast two-hybrid or split-ubiquitin assays for membrane proteins

  • In vivo validation:

    • Co-localization studies using super-resolution microscopy

    • FRET or FLIM-FRET to confirm proximity in living cells

    • Genetic interaction studies (synthetic lethality or suppression)

    • Phenotypic analysis of double knockout/knockdown mutants

By combining these approaches, researchers can build a high-confidence interaction network for FCJ1 and validate the biological significance of these interactions in maintaining mitochondrial architecture and function.

What phenotypic changes occur in mitochondria when FCJ1 is deleted or overexpressed?

FCJ1 deletion and overexpression produce distinct and opposing phenotypes, providing strong evidence for its direct role in mitochondrial architecture:

When FCJ1 is deleted:

  • Ultrastructural changes:

    • Complete absence of crista junctions

    • Formation of concentric stacks of inner membrane within the mitochondrial matrix

    • Altered cristae morphology with increased membrane stacking

  • Molecular changes:

    • Increased levels of F1FO-ATP synthase supercomplexes

    • Formation of "zipper-like" structures with regular 14-16 nm spacing between F1FO particles

    • Disruption of MICOS complex integrity

  • Functional consequences:

    • Loss of respiratory competence

    • Altered inheritance of mitochondrial DNA

    • Impaired communication between intermembrane space and intracristal space

When FCJ1 is overexpressed:

  • Ultrastructural changes:

    • Increased formation of crista junctions (two- to threefold increase)

    • Branching of cristae membranes

    • Enlargement of crista junction diameter

    • Increased interconnectivity of the cristae membrane system

  • Molecular changes:

    • Reduced levels of F1FO-ATP synthase supercomplexes

    • Altered distribution of other inner membrane proteins

  • Functional consequences:

    • Potentially altered bioenergetic efficiency

    • Modified calcium handling and apoptotic signaling

    • Changes in mitochondrial membrane potential distribution

These opposing phenotypes demonstrate that FCJ1 levels must be precisely regulated to maintain proper mitochondrial morphology and function, with both deficiency and excess leading to significant alterations in organelle architecture.

How can researchers quantitatively assess crista junction formation and morphology in relation to FCJ1 expression?

Researchers can employ several quantitative methods to assess crista junction formation and morphology in relation to FCJ1 expression:

By combining these approaches, researchers can establish quantitative relationships between FCJ1 expression levels and specific aspects of mitochondrial ultrastructure, providing insights into the mechanisms by which FCJ1 controls crista junction formation.

What approaches can be used to study how FCJ1 affects mitochondrial function beyond structural changes?

Beyond its structural role, FCJ1 impacts various aspects of mitochondrial function that can be studied using the following approaches:

  • Bioenergetic analysis:

    • Oxygen consumption measurements using respirometry to assess respiratory chain function

    • ATP synthesis assays to determine the efficiency of oxidative phosphorylation

    • Membrane potential measurements using potentiometric dyes (TMRM, JC-1) to assess the proton motive force

    • Extracellular flux analysis to measure glycolytic versus oxidative metabolism in intact cells

  • Mitochondrial calcium handling:

    • Calcium uptake assays using fluorescent indicators or genetically encoded calcium sensors

    • Analysis of mitochondrial calcium uniporter (MCU) complex assembly and function

    • Assessment of calcium-induced permeability transition in isolated mitochondria

  • Reactive oxygen species (ROS) production:

    • Measurement of superoxide and hydrogen peroxide generation using specific probes

    • Assessment of oxidative damage to mitochondrial proteins, lipids, and DNA

    • Analysis of antioxidant enzyme activities and redox state

  • Mitochondrial DNA maintenance:

    • Quantification of mtDNA copy number

    • Analysis of mtDNA distribution and nucleoid structure

    • Assessment of mtDNA replication and transcription rates

    • Measurement of heteroplasmy levels in cells with mixed mtDNA populations

  • Protein import and quality control:

    • In vitro and in vivo protein import assays to assess the efficiency of various import pathways

    • Analysis of mitochondrial protease activities and substrate processing

    • Assessment of mitochondrial unfolded protein response activation

  • Apoptotic signaling:

    • Cytochrome c release assays

    • Measurement of caspase activation

    • Assessment of mitochondrial outer membrane permeabilization

    • Analysis of interactions between pro- and anti-apoptotic Bcl-2 family proteins

  • Systems biology approaches:

    • Proteomics analysis to identify global changes in protein abundance and post-translational modifications

    • Metabolomics to assess alterations in mitochondrial metabolic pathways

    • Transcriptomics to identify retrograde signaling effects on nuclear gene expression

These multifaceted approaches can reveal how FCJ1-mediated structural changes translate into functional consequences for mitochondrial performance and cellular homeostasis.

What are the optimal conditions for storing and handling recombinant Candida tropicalis FCJ1 protein?

Optimal storage and handling conditions for recombinant Candida tropicalis FCJ1 protein are critical to maintain its structural integrity and functional activity:

Storage conditions:

  • Short-term storage (up to one week): Working aliquots can be stored at 4°C in appropriate buffer without significant loss of activity .

  • Long-term storage options:

    • Store at -20°C/-80°C in storage buffer containing 50% glycerol as a cryoprotectant

    • For maximum stability, store as lyophilized powder at -20°C

    • Divide into single-use aliquots to avoid repeated freeze-thaw cycles

  • Storage buffer composition:

    • Tris/PBS-based buffer, pH 8.0

    • 6% Trehalose as a stabilizing agent

    • 50% Glycerol for frozen storage

Handling recommendations:

  • Reconstitution protocol:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for aliquots intended for longer storage

  • Thawing procedure:

    • Thaw frozen aliquots quickly in a water bath at room temperature

    • Once thawed, keep on ice and use promptly

    • Avoid repeated freeze-thaw cycles, as this can lead to protein denaturation and aggregation

  • Working with the protein:

    • Maintain the protein at 4°C during experimental procedures

    • Use low-binding microcentrifuge tubes to prevent protein loss through adsorption

    • Include protease inhibitors in working buffers if procedures are lengthy

    • Filter solutions through 0.22 μm filters to remove any precipitates before use

Following these recommendations will help maintain the structural integrity and functional activity of recombinant FCJ1 protein for reliable experimental results.

What experimental pitfalls should researchers be aware of when working with recombinant FCJ1 protein?

Researchers working with recombinant FCJ1 protein should be aware of several potential pitfalls that could affect experimental outcomes:

  • Tag selection and positioning issues:

    • C-terminal tagging can significantly impair FCJ1's interactions with other MICOS components, as demonstrated by co-isolation experiments

    • While C-terminally tagged FCJ1 can rescue deletion phenotypes, it may not fully replicate all protein-protein interactions

    • N-terminal tagging is preferable for studying protein interactions, but may affect membrane insertion

  • Protein solubility challenges:

    • FCJ1 is a membrane protein and may have limited solubility in aqueous buffers

    • Protein aggregation can occur during purification or storage

    • Use appropriate detergents or lipid environments to maintain native conformation

  • Expression system limitations:

    • E. coli expression systems may not reproduce all post-translational modifications present in Candida tropicalis

    • Proper folding may be compromised in heterologous expression systems

    • Consider using yeast expression systems for more authentic protein structure

  • Functional assay considerations:

    • In vitro assays may not fully recapitulate the complex mitochondrial membrane environment

    • Membrane curvature effects may require reconstitution into liposomes or nanodiscs

    • Interaction studies should account for the membranous nature of FCJ1 and its partners

  • Protein stability issues:

    • FCJ1 may be sensitive to oxidation of critical cysteine residues

    • Repeated freeze-thaw cycles can lead to progressive loss of activity

    • Protein may undergo time-dependent conformational changes in solution

  • Species-specific differences:

    • FCJ1 homologs from different species may have distinct functional properties

    • Candida tropicalis FCJ1 may not functionally substitute for homologs in other experimental systems

    • Consider evolutionary conservation when designing experiments or interpreting results

  • Technical considerations:

    • The large size and complex topology of FCJ1 may present challenges for structure-function studies

    • Limited availability of Candida tropicalis-specific antibodies may necessitate the use of epitope tags

    • Physiological oligomeric state may be difficult to preserve during purification

Awareness of these potential pitfalls can help researchers design more robust experiments and correctly interpret their results when working with recombinant FCJ1 protein.

How can researchers verify the proper folding and activity of recombinant FCJ1 protein for functional studies?

Verifying proper folding and activity of recombinant FCJ1 protein is essential for reliable functional studies. Researchers can employ the following methods:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content and compare with predicted values

    • Thermal shift assays to determine protein stability and proper folding

    • Limited proteolysis to probe for exposed flexible regions, indicating correct folding

    • Size exclusion chromatography to verify expected oligomeric state and absence of aggregation

  • Functional verification:

    • Binding assays with known interaction partners (e.g., other MICOS components or TOB/SAM complex)

    • Reconstitution into liposomes to assess membrane association and topology

    • Complementation assays in FCJ1-deficient cells or mitochondria to verify functional rescue

    • Membrane bending assays to assess the protein's ability to induce negative curvature

  • Domain-specific validation:

    • Verify C-terminal domain functionality through interaction studies with TOB/SAM complex components

    • Assess oligomerization capacity through crosslinking or analytical ultracentrifugation

    • Compare activity of full-length protein with isolated domains to confirm interdomain relationships

  • Immunological methods:

    • Conformational epitope-specific antibodies to verify native structure

    • Limited epitope mapping to confirm proper domain exposure

    • ELISA-based binding assays to quantify interaction with known partners

  • Biophysical characterization:

    • Microscale thermophoresis to assess binding affinities with interaction partners

    • Surface plasmon resonance to determine binding kinetics

    • Dynamic light scattering to verify homogeneity and absence of aggregation

  • In vitro functional assays:

    • Membrane tubulation assays using giant unilamellar vesicles

    • Cryo-electron microscopy of proteoliposomes to visualize membrane deformation

    • FRET-based assays to monitor protein-protein interactions in a membrane environment

By combining multiple methods to assess both structural integrity and functional activity, researchers can confidently proceed with experiments using properly folded and active recombinant FCJ1 protein, improving the reliability and reproducibility of their results.

What are the most significant unresolved questions about FCJ1 function that require further investigation?

Despite significant advances in understanding FCJ1 function, several important questions remain unresolved and warrant further investigation:

  • Structural mechanisms of membrane remodeling:

    • How does FCJ1 precisely induce the negative membrane curvature required for crista junction formation?

    • What is the high-resolution structure of FCJ1 and how does it change upon membrane association?

    • How do FCJ1 oligomers assemble to stabilize the unique tubular structure of crista junctions?

  • Regulatory mechanisms:

    • How is FCJ1 expression and activity regulated in response to metabolic demands?

    • What post-translational modifications affect FCJ1 function?

    • How do cells adjust the antagonistic relationship between FCJ1 and F1FO-ATP synthase to adapt mitochondrial architecture to changing conditions?

  • Species-specific functions:

    • How do the functions of Candida tropicalis FCJ1 compare to homologs in other fungi and in mammals?

    • Are there unique properties of Candida tropicalis FCJ1 related to this organism's metabolism or lifestyle?

    • Can functional differences between species be exploited for antifungal development?

  • Pathological relevance:

    • How do alterations in FCJ1 function contribute to mitochondrial dysfunction in disease states?

    • Could FCJ1 be a therapeutic target for diseases associated with mitochondrial morphology defects?

    • What is the relationship between FCJ1 function and mitochondrial quality control pathways?

  • Integration with other cellular processes:

    • How does FCJ1 coordinate with mitochondrial fusion and fission machinery?

    • What is the role of FCJ1 in mitochondrial-associated membranes (MAMs) and ER-mitochondria contacts?

    • How does FCJ1 influence mitochondrial transport and positioning in polarized cells?

  • Evolutionary aspects:

    • How has the FCJ1/mitofilin family evolved across different organisms?

    • What are the minimal structural elements required for FCJ1 function?

    • How did the MICOS complex assembly evolve in relation to increasing mitochondrial complexity?

Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, genetic manipulation, and systems biology to fully elucidate the complex roles of FCJ1 in mitochondrial architecture and function.

What emerging technologies might advance our understanding of FCJ1 function and mitochondrial architecture?

Emerging technologies offer promising avenues to advance our understanding of FCJ1 function and mitochondrial architecture:

  • Advanced structural biology techniques:

    • Cryo-electron tomography with subtomogram averaging to visualize FCJ1 in its native membrane environment

    • Single-particle cryo-EM to determine high-resolution structures of FCJ1 and MICOS complexes

    • Integrative structural biology approaches combining X-ray crystallography, NMR, and SAXS to characterize flexible regions

  • Super-resolution imaging advances:

    • Live-cell super-resolution microscopy with improved temporal resolution to track dynamic changes in crista junction architecture

    • Expansion microscopy to physically enlarge specimens for improved resolution of mitochondrial ultrastructure

    • Correlative light and electron microscopy with increased throughput to relate protein dynamics to ultrastructure

  • Artificial intelligence and computational approaches:

    • Machine learning for automated segmentation and analysis of mitochondrial ultrastructure

    • Molecular dynamics simulations to model FCJ1 membrane interactions and protein complexes

    • Systems biology modeling to integrate structural, functional, and 'omics data

  • Genome editing and screening technologies:

    • CRISPR-based screening to identify novel regulators of FCJ1 function

    • Base editing and prime editing for precise modification of FCJ1 to study structure-function relationships

    • CRISPRi/CRISPRa for temporal control of FCJ1 expression

  • Advanced biochemical tools:

    • Proximity labeling with improved spatial resolution to map the FCJ1 interactome at suborganellar resolution

    • Nanobodies and synthetic binding proteins as tools to probe and manipulate FCJ1 function

    • In vitro reconstitution systems with increased complexity to recapitulate mitochondrial membrane architecture

  • Organoid and stem cell technologies:

    • Mitochondrial disease models using patient-derived induced pluripotent stem cells

    • Organoid systems to study FCJ1 function in tissue-specific contexts

    • Microphysiological systems to assess mitochondrial function in complex tissue environments

  • Single-cell approaches:

    • Single-cell proteomics to analyze cell-to-cell variability in mitochondrial protein composition

    • Spatial transcriptomics to relate mitochondrial gene expression to subcellular positioning

    • Combined imaging and 'omics approaches to correlate mitochondrial structure with function at the single-cell level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.