Recombinant Candida tropicalis Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET2; CTRG_03384; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)
Target Names
GET2
Target Protein Sequence
MSDSTDSPAVLSAEEKRRLLRERRQAKMAKGQATDRLNNILSQGSSVKTTGVKSVLDEPQ PTATSSAIHDEDPDIQDISEIASPPPPTPPIGEGSPENIDDIFQKMLQQQVQGKDGKVDP NDPIVQIMNMFKDGSGADGPQEGDVNANEFSNDPVENKYQQDLQAYDTYQQKLWKSRFLV IRVVVTLFNFFYHYLNVPSFHASNYSYVRDLAQDEFPVRNFFTWFAAFEVIIVLQYYTVF HKLGLFHAANQNSMIMKLMSMGSMVLPQLNTYQPLVARFLGYYELFGIIFGDLSLVIVLF GLLSFTK
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins possessing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.
Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does C. tropicalis GET2 compare to GET2 proteins in other Candida species?

GET2 proteins are highly conserved across Candida species, reflecting their essential role in protein trafficking. Multiple commercial sources offer recombinant GET2 proteins from various Candida species including C. albicans, C. dubliniensis, and C. glabrata . Functional complementation studies have demonstrated that C. tropicalis GET2 can partially restore function when expressed in C. albicans mutants, suggesting conservation of key functional domains .

Unlike some other proteins in C. tropicalis that show significant divergence from their orthologs in C. albicans, GET2 maintains high sequence similarity across species, making it a reliable target for comparative studies of protein trafficking mechanisms in pathogenic fungi .

How is GET2 regulated in C. tropicalis during stress conditions?

Under stress conditions, particularly those affecting the secretory pathway, GET2 expression in C. tropicalis is upregulated. This occurs as part of the unfolded protein response, which is activated when misfolded proteins accumulate in the ER. Research indicates that GET2 plays a role in the stress adaptation of C. tropicalis, particularly during osmotic stress, which is consistent with its characterization as an osmotolerant microorganism .

Unlike some other trafficking proteins that are dispensable under normal growth conditions, GET2 function becomes critical when cells are exposed to antifungal agents that target the cell wall or membrane, suggesting its importance in maintaining cellular homeostasis during stress .

What role does GET2 play in C. tropicalis pathogenicity and virulence?

GET2 contributes to C. tropicalis pathogenicity through its role in protein trafficking, which impacts several virulence factors:

  • Cell wall integrity: GET2 participates in the proper trafficking of cell wall proteins and enzymes involved in cell wall biogenesis. Disruption of GET2 affects cell wall composition, particularly mannan content, which is crucial for host-pathogen interactions .

  • Biofilm formation: C. tropicalis is recognized as a strong biofilm producer, often surpassing C. albicans . GET2-mediated protein trafficking contributes to the secretion of extracellular matrix components necessary for robust biofilm formation.

  • Stress response: GET2 facilitates adaptation to stress conditions encountered during infection, including oxidative stress from host immune cells and osmotic stress in different host environments .

  • Morphogenesis: C. tropicalis can produce true hyphae, which are important for tissue invasion. GET2 involvement in protein trafficking affects the expression of hyphal-specific proteins on the cell surface .

Recent studies with other protein trafficking components in C. tropicalis (such as Pmt2) have demonstrated that disrupting trafficking pathways can attenuate virulence in Galleria mellonella larvae infection models, suggesting GET2 may have similar importance .

How does O-linked mannosylation impact GET2 function in C. tropicalis?

O-linked mannosylation significantly impacts GET2 function through several mechanisms:

  • Protein stability: O-linked mannans contribute to the stability and correct folding of GET2, affecting its half-life and proper localization in the membrane.

  • Protein-protein interactions: Mannosylation modifies the surface properties of GET2, potentially altering its interactions with other components of the trafficking machinery.

  • Trafficking regulation: Research with C. tropicalis pmt2Δ null mutants (affected in the first step of O-linked mannosylation) demonstrated that O-linked mannans are required for proper protein secretion and cell wall integrity .

The recent finding that PMT2 (protein O-mannosyltransferase) is dispensable in C. tropicalis but essential in C. albicans suggests species-specific differences in how mannosylation affects trafficking proteins like GET2 . This presents interesting research opportunities to understand species-specific differences in protein glycosylation and trafficking.

What are the optimal expression systems for producing recombinant C. tropicalis GET2?

Several expression systems have been utilized for producing recombinant C. tropicalis GET2, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coli- Cost-effective
- High yield
- Simple purification protocols
- Suitable for structural studies
- Lack of post-translational modifications
- Potential issues with membrane protein folding
- May require refolding from inclusion bodies
5-10 mg/L culture
Mammalian cells- Native-like post-translational modifications
- Proper folding of complex proteins
- Better for functional studies
- Higher cost
- Longer production time
- Lower yield
1-3 mg/L culture
Yeast systems- Closer to native environment
- Capable of proper glycosylation
- Good for functional studies
- Moderate yield
- May have species-specific modifications
2-5 mg/L culture

What purification strategies are most effective for recombinant C. tropicalis GET2?

Effective purification of recombinant C. tropicalis GET2 typically involves a multi-step approach:

  • Affinity chromatography: His-tagged GET2 can be efficiently purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins . This step typically achieves >85% purity.

  • Size exclusion chromatography (SEC): To remove aggregates and improve purity to >95%, SEC is recommended as a second purification step.

  • Detergent selection: As a transmembrane protein, GET2 requires appropriate detergents for extraction and stabilization. Common choices include:

    • n-Dodecyl β-D-maltoside (DDM) for initial extraction

    • n-Octyl β-D-glucopyranoside (OG) for crystallization studies

    • Lauryl maltose neopentyl glycol (LMNG) for long-term stability

  • Buffer optimization: Recommended buffers include:

    • Extraction: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1% DDM

    • Purification: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM

    • Storage: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% DDM, 10% glycerol

For optimal results, purification should be performed at 4°C to minimize protein degradation, and protease inhibitors should be included in early purification steps .

What are the recommended storage conditions for maintaining the stability of recombinant C. tropicalis GET2?

Proper storage is critical for maintaining the stability and activity of recombinant C. tropicalis GET2:

  • Temperature: Store at -20°C/-80°C for long-term storage. For working aliquots, 4°C is suitable for up to one week .

  • Buffer components:

    • Include 6% trehalose in Tris/PBS-based buffer at pH 8.0

    • Add 5-50% glycerol (final concentration) for cryoprotection, with 50% being optimal for most applications

  • Aliquoting: To prevent repeated freeze-thaw cycles, which significantly reduce protein activity, divide the purified protein into small single-use aliquots before freezing .

  • Reconstitution: For lyophilized protein, briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Shelf life: Under optimal storage conditions, the shelf life is approximately:

    • 6 months for liquid form at -20°C/-80°C

    • 12 months for lyophilized form at -20°C/-80°C

Regular quality control testing for activity and integrity is recommended for proteins stored longer than their recommended shelf life.

How can researchers use recombinant C. tropicalis GET2 to study protein trafficking in pathogenic fungi?

Researchers can utilize recombinant C. tropicalis GET2 for multiple experimental approaches to study protein trafficking:

  • Reconstitution assays: Purified recombinant GET2 can be incorporated into liposomes or nanodiscs to study its function in minimal reconstituted systems. This approach allows precise control over membrane composition and interaction partners.

  • Pull-down assays: His-tagged GET2 can be used to identify interaction partners in C. tropicalis lysates, helping map the protein trafficking interactome specific to this pathogen.

  • Comparative studies: Using recombinant GET2 from multiple Candida species allows researchers to investigate species-specific differences in trafficking machinery that may contribute to differential virulence or drug resistance .

  • Structural studies: Purified recombinant GET2 can be used for structural determination via X-ray crystallography or cryo-EM, providing insights into the molecular mechanisms of trafficking.

  • Inhibitor screening: The protein can serve as a target for screening potential antifungal compounds that disrupt trafficking pathways in C. tropicalis.

These approaches have been successfully employed to study related trafficking components in C. albicans and could be adapted for C. tropicalis GET2 research .

What detection methods can reliably identify native and recombinant GET2 in experimental systems?

Several detection methods have proven reliable for identifying GET2 in experimental systems:

  • Western blotting: Using antibodies against the His-tag for recombinant protein or custom antibodies against GET2 peptides. Typical dilutions range from 1:1000 to 1:5000, with overnight incubation at 4°C yielding optimal results.

  • Immunofluorescence microscopy: For localization studies, using fluorescently labeled antibodies or expressing GET2 fused to fluorescent proteins (GFP, mCherry) to visualize its distribution within cells.

  • Mass spectrometry: For identification and quantification of GET2 in complex samples, with typical peptide coverage of 60-75% for trypsin digestion.

  • RPA-LFS detection: While primarily developed for C. tropicalis detection, the principles of Recombinase Polymerase Amplification combined with Lateral Flow Strip (RPA-LFS) could be adapted to detect GET2 expression .

For molecular detection of GET2 expression at the gene level, species-specific primers targeting the GET2 gene (CTRG_03384) can be used in RT-PCR assays, with proper controls to ensure specificity against other Candida species .

How can researchers effectively design mutations in GET2 to study structure-function relationships?

Strategic mutation design for GET2 structure-function studies should focus on key functional domains:

  • Transmembrane domain mutations: Modifications to the transmembrane regions (approximately residues 150-170 and 250-270) can help identify segments essential for membrane anchoring and protein stability.

  • Cytoplasmic domain mutations: Alterations to N-terminal residues (1-149) can reveal regions important for interactions with cytosolic partners in the GET complex.

  • Conserved residue targeting: Alignment of GET2 sequences across fungal species can identify highly conserved residues likely critical for function. These make prime targets for alanine scanning mutagenesis.

  • Phosphorylation site modifications: Potential regulatory phosphorylation sites can be mutated to phosphomimetic (e.g., S→D or T→E) or non-phosphorylatable (S→A or T→A) forms to study post-translational regulation.

  • Domain deletion/swapping: Creating chimeric proteins by swapping domains between GET2 from different Candida species can help identify species-specific functional regions.

For introduction of mutations, site-directed mutagenesis PCR on expression plasmids is typically most efficient, with verification by sequencing before expression . CRISPR-Cas9 systems adapted for C. tropicalis can also be used for genomic modifications to study GET2 in its native context.

What is the role of GET2 in relation to other protein trafficking components in C. tropicalis?

GET2 functions within a complex network of protein trafficking components in C. tropicalis:

  • GET complex components: GET2 interacts with other GET complex members to facilitate tail-anchored protein insertion into the ER membrane. While specific C. tropicalis GET complex composition hasn't been fully characterized, research in related species suggests GET2 works in concert with GET1 and GET3 homologs .

  • KDEL receptors: GET2 functions alongside KDEL receptors that mediate Golgi-ER retrieval of ER resident proteins. The KDEL system recognizes tetrapeptide motifs (KDEL or HDEL) and works in parallel with GET-mediated trafficking .

  • Erv41-Erv46 complex: This complex retrieves ER resident proteins lacking known sorting signals and operates in a pH-dependent manner similar to KDEL receptors. GET2 likely complements this system for specific cargo types .

  • Rer1 receptor: The ER retrieval receptor Rer1 mediates Golgi-ER traffic of membrane proteins lacking conventional retrieval signals. GET2 may coordinate with Rer1 for comprehensive protein quality control .

Recent studies suggest that these systems don't function in isolation but form an integrated network for maintaining proper protein distribution in the secretory pathway .

How does protein mannosylation affect GET2 function and trafficking efficiency?

Protein mannosylation significantly impacts GET2 function through multiple mechanisms:

  • Direct modification: GET2 itself may be subject to mannosylation, which could affect its conformation, stability, and interaction with partner proteins. Studies with the protein O-mannosyltransferase PMT2 suggest widespread effects of mannosylation on membrane proteins in C. tropicalis .

  • Cargo modification: Many GET2 cargo proteins undergo mannosylation, which can serve as a quality control signal. Improperly mannosylated proteins may not be recognized efficiently by the trafficking machinery .

  • pH-dependent interactions: Mannosylation can alter the pH sensitivity of protein interactions in the ER-Golgi system. Since many trafficking receptors operate through pH-dependent binding and release mechanisms, mannosylation status can regulate trafficking kinetics .

  • Cell wall integrity: Disruption of mannosylation pathways affects cell wall integrity, which indirectly impacts secretory pathway function and GET2-mediated trafficking .

Research with C. tropicalis pmt2Δ mutants has shown that disrupting O-linked mannosylation affects protein secretion and cell wall organization, suggesting close coordination between mannosylation and trafficking pathways .

What techniques are emerging for studying GET2 dynamics in live C. tropicalis cells?

Several cutting-edge techniques are emerging for studying GET2 dynamics in live cells:

  • CRISPR-based tagging: CRISPR-Cas9 systems adapted for C. tropicalis enable endogenous tagging of GET2 with fluorescent proteins or small epitope tags, allowing visualization of the native protein without overexpression artifacts.

  • Super-resolution microscopy: Techniques like Structured Illumination Microscopy (SIM) and Stochastic Optical Reconstruction Microscopy (STORM) provide nanoscale resolution of GET2 localization and dynamics in the secretory pathway.

  • FRET/FLIM analysis: Förster Resonance Energy Transfer (FRET) coupled with Fluorescence Lifetime Imaging Microscopy (FLIM) enables real-time monitoring of GET2 interactions with partner proteins in living cells.

  • Optogenetics: Light-responsive domains integrated into GET2 allow precise spatiotemporal control of its function, enabling researchers to trigger trafficking events on demand and observe subsequent cellular responses.

  • Proximity labeling: Techniques like BioID or APEX2 fusion to GET2 enable mapping of its dynamic interactome in living cells, capturing even transient interactions within the trafficking machinery.

These emerging approaches complement traditional biochemical methods and are beginning to provide unprecedented insights into the dynamic nature of protein trafficking in pathogenic fungi like C. tropicalis .

What are the most significant unanswered questions about C. tropicalis GET2?

Despite advances in understanding GET2 function, several significant questions remain unanswered:

  • Species-specific functions: How does C. tropicalis GET2 function differ from its orthologs in other Candida species, particularly regarding cargo specificity and interactions with other trafficking components?

  • Pathogenicity role: What specific virulence factors depend on GET2-mediated trafficking, and how does this contribute to C. tropicalis pathogenicity in different infection models?

  • Stress response: How does GET2 function adapt during various stress conditions encountered during infection, including antifungal exposure, nutrient limitation, and host immune responses?

  • Regulatory mechanisms: What post-translational modifications regulate GET2 activity, and how are these coordinated with cellular stress responses and morphological transitions?

  • Therapeutic targeting: Can GET2 or associated trafficking pathways be effectively targeted for antifungal development without excessive toxicity to host cells?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.