Recombinant Candida tropicalis Probable metalloreductase AIM14 (AIM14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AIM14; CTRG_01201; Probable metalloreductase AIM14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)
Target Names
AIM14
Target Protein Sequence
MNTISPVVIEPRHGGEHHSVNVKYGIIIFAISVIHILFFLLVKFIEINRWKSNGRFNKSL WKLNNTPTWMLITLWILIIFFIGGANITEFSEEYITIAKRYGRIAYCLLPLNIYLILRPT NCVYLKPGYYLENLSLHKWLSRLISICTLIHAIGYFYKWNKEGKILIKSFRFLNFLGIVV FVMFAVLIIVSIRILRRKYYSLFYIIHNITAWSMVVLIIFHARPGVTIFGIICLILMCYQ LLYLRFYKSYPVNNLKIVDIPMSTLQIIKIPKPSNFPTWLPGSHVRLNYTTSNIKSWINS SHPFTIANIPEDGVNYLSLVIKKPGNFIIDQYLTYLLTGPYISIDYPFYNSANLINIICG GSGISFGLPILNHYKSLNSNIPIKLIWCVRNRNDCFIMNQLDMTNVEVFITSAGDSSSDE QSPSSSSYQPVPLFVVDDEQDESHAKVEQTQGEEEVDGLLNQDENGIPLQSMKKESFPKK EEGEDEEKSSKDVFKYGRPKFDEVFAIDDPTLNPNYNDSWVIACGPDQLIEDAKYWSQEK GYRFFSEKYEM
Uniprot No.

Target Background

Function
This protein is a probable cell surface metalloreductase. It may be involved in iron or copper homeostasis.
Database Links
Protein Families
Ferric reductase (FRE) family, AIM14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Candida tropicalis and why is it clinically significant?

Candida tropicalis is a pathogenic yeast species that can cause bloodstream infections (BSIs). It is clinically significant due to its ability to cause invasive candidiasis, which can be life-threatening, especially in immunocompromised patients. C. tropicalis is one of the three common Candida species in clinical settings in China, alongside C. albicans (CA) and C. glabrata (CG) . The timely diagnosis and effective treatment of Candida bloodstream infections rely heavily on rapid and sensitive detection methods, as conventional blood culture methods (the current gold standard) suffer from long turn-around times and low detection rates .

What are metalloreductases in Candida species and what function might AIM14 serve?

Metalloreductases in fungal species like Candida typically play roles in metal ion homeostasis, contributing to various cellular processes including iron acquisition, respiration, and response to oxidative stress. While the search results don't provide specific information about AIM14's function in C. tropicalis, metalloreductases generally catalyze the reduction of metal ions, which can be essential for fungal survival and virulence. In the context of C. tropicalis, AIM14 likely participates in cellular processes related to metal utilization, possibly contributing to the organism's pathogenicity and survival in host environments.

What detection methods are currently available for Candida tropicalis in blood samples?

Current detection methods for C. tropicalis in blood samples include:

  • Blood culture (gold standard): While considered the benchmark method, it has limitations including long turn-around time (24-72 hours) and low detection rates, making rapid diagnosis challenging .

  • Conventional qPCR: Molecular method with improved turn-around time compared to blood culture but with limited sensitivity when applied directly to blood samples due to inhibitors present in blood .

  • M1-mRAP method: A novel approach combining recombinant human mannan-binding lectin beads (M1 beads) for Candida enrichment with multiplex recombinase-aided PCR (mRAP) for DNA amplification. This method demonstrates high sensitivity with a limit of detection of 2 CFU/mL for C. tropicalis and a rapid turnaround time of approximately 3.5 hours .

How does the M1-mRAP method compare with conventional detection methods for Candida tropicalis?

The M1-mRAP method represents a significant advancement over conventional detection methods for C. tropicalis, particularly in terms of sensitivity and speed. Compared to traditional qPCR methods, M1-mRAP demonstrated superior clinical detection capabilities. In a study evaluating 9 blood samples, M1-mRAP detected positive samples that were classified in the qPCR grey zone, indicating enhanced sensitivity .

The primary advantages of M1-mRAP include:

  • Superior sensitivity: Limit of detection (LOD) of 2 CFU/mL for C. tropicalis in simulated blood samples, compared to approximately 200 CFU/mL for standard qPCR without M1 enrichment .

  • Rapid detection: Approximately 3.5 hours total detection time, significantly faster than blood culture (24-72 hours) .

  • Multiplex capability: Simultaneous detection of multiple Candida species (C. albicans, C. tropicalis, and C. glabrata) in a single reaction, improving diagnostic efficiency .

  • Improved workflow: Compared to previous dual-RAP methods, the mRAP component employs only one pair of RAA primers for each target and integrates RAA and qPCR systems into a Docosane-free single-system reaction, providing a simpler reaction system .

What are the molecular mechanisms behind M1 beads' enrichment of Candida species in blood samples?

The molecular mechanism behind M1 beads' enrichment of Candida species involves the specific recognition of polysaccharide residues on the fungal cell surface. M1 beads are prepared using recombinant human mannan-binding lectin protein (rhMBL or M1 protein), which has a high binding affinity for Candida cells .

The enrichment process works through the following mechanisms:

  • Specific binding: M1 beads recognize and bind to mannan structures on the Candida cell wall. Mannan is a polysaccharide component found abundantly in fungal cell walls.

  • Magnetic separation: After binding to Candida cells, the M1 magnetic beads allow for the physical separation of Candida from other blood components through magnetic force.

  • Concentration effect: This process effectively increases the relative concentration of Candida cells in the sample while removing blood components that might inhibit subsequent DNA amplification .

This enrichment strategy significantly enhances detection sensitivity, as demonstrated by the substantial difference in detection sensitivity between M1-qPCR and standard qPCR (4 vs. 200 CFU/mL for C. albicans) .

What factors influence the performance of recombinant metalloreductases in experimental settings?

While the search results don't specifically address factors influencing recombinant metalloreductase performance, general considerations for recombinant enzymes in experimental settings would include:

  • Expression system: The choice of expression system can significantly impact protein folding, post-translational modifications, and enzymatic activity.

  • Purification method: Different purification strategies may affect protein yield, purity, and retention of native activity.

  • Buffer conditions: pH, ionic strength, and the presence of cofactors can substantially influence metalloreductase activity.

  • Metal ion availability: As metalloreductases require metal ions for their function, the availability and concentration of relevant metal ions in the reaction environment are critical.

  • Redox environment: The reducing or oxidizing conditions in the reaction environment may affect the enzyme's catalytic activity.

For AIM14 specifically, these factors would need to be carefully optimized in experimental settings to ensure maximum enzymatic activity.

How can researchers optimize the M1-mRAP method for detection of Candida tropicalis in clinical samples?

Researchers can optimize the M1-mRAP method for C. tropicalis detection through several strategies:

  • Sample freshness: Ensure blood samples are fresh to maximize the number of viable Candida cells, as M1 beads preferentially adsorb viable cells .

  • M1 bead preparation: Prepare M1 beads within 14 days of use and store at 4°C to maintain optimal binding capacity .

  • Primer design optimization: Carefully design and screen primers for the mRAP component to ensure specificity for C. tropicalis while avoiding cross-reactivity with other fungal species.

  • Morphological considerations: Account for the different morphologies of C. tropicalis (yeast, hyphae, and pseudohyphae) which may affect mannan structure and consequently M1 bead binding efficiency. Additional experiments to verify enrichment against specific morphologies may be necessary .

  • Protocol standardization: Establish standardized protocols for sample processing, M1 enrichment, and mRAP amplification to ensure reproducibility across different laboratories and clinical settings.

What are the technical challenges in developing antifungal strategies targeting Candida tropicalis metalloreductases?

Developing antifungal strategies targeting C. tropicalis metalloreductases, including potentially AIM14, would face several technical challenges:

  • Target specificity: Ensuring that inhibitors specifically target fungal metalloreductases without affecting human metalloenzymes to avoid toxicity.

  • Drug resistance mechanisms: C. tropicalis is known to develop resistance to conventional antifungal agents. For example, research has shown that C. tropicalis ATCC 28707 is resistant to fluconazole, itraconazole, and amphotericin B .

  • Drug efflux pumps: Overexpression of drug efflux pumps at the plasma membrane is a known mechanism for fungal escape from antifungal drugs . Any new therapeutics would need to address this resistance mechanism.

  • Biofilm formation: C. tropicalis forms biofilms that can protect the fungal cells from antifungal agents. New therapeutic approaches would need to penetrate or disrupt these biofilms .

  • Validation methodologies: Establishing appropriate assays to evaluate the efficacy of potential inhibitors, including minimum inhibitory concentration (MIC) and minimum fungicidal concentration (MFC) determinations, time-kill kinetics, and biofilm inhibition assays .

How can researchers evaluate the functional roles of AIM14 in Candida tropicalis pathogenicity?

To evaluate the functional roles of AIM14 in C. tropicalis pathogenicity, researchers could employ the following methodologies:

  • Gene knockout/knockdown studies: Using CRISPR-Cas9 or RNA interference techniques to create AIM14-deficient strains and assess their virulence in comparison to wild-type strains.

  • Protein expression and purification: Express and purify recombinant AIM14 to characterize its biochemical properties and enzymatic activities in vitro.

  • Localization studies: Use fluorescent tagging or immunolocalization to determine the subcellular localization of AIM14 during different stages of infection.

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and AIM14-deficient strains under various conditions relevant to pathogenicity.

  • Animal infection models: Assess the virulence of AIM14-deficient strains in appropriate animal models of candidiasis.

  • Interaction studies: Identify potential protein-protein interactions or metabolic pathways involving AIM14 that may contribute to virulence.

What analytical performance metrics should be considered when validating detection methods for Candida tropicalis?

When validating detection methods for C. tropicalis, several analytical performance metrics should be considered:

Performance MetricDescriptionM1-mRAP Performance for C. tropicalis
Limit of detection (LOD)Lowest concentration that can be reliably detected2 CFU/mL in simulated blood samples
Analytical sensitivityAbility to detect small amounts of the target2 copies/μL using recombinant plasmids
Analytical specificityAbility to distinguish the target from similar organismsNot explicitly stated in search results
Turn-around timeTotal time from sample collection to resultApproximately 3.5 hours
Clinical sensitivityProportion of true positives correctly identifiedDetected 11.1% more positive samples than qPCR
Clinical specificityProportion of true negatives correctly identifiedConsistent with qPCR (P<0.05)
ReproducibilityConsistency of results across different runsNot explicitly stated in search results
RobustnessPerformance under varying conditionsNot explicitly stated in search results

These metrics provide a comprehensive assessment of a detection method's performance and reliability in clinical settings.

How can researchers integrate AIM14-related findings with broader understanding of Candida tropicalis virulence factors?

Researchers can integrate AIM14-related findings with the broader understanding of C. tropicalis virulence factors through several approaches:

  • Systems biology: Employ computational models to understand how AIM14 functions within the broader network of virulence factors and metabolic pathways in C. tropicalis.

  • Comparative genomics: Compare the AIM14 gene and its regulatory elements across different Candida species to identify conserved or divergent features that might relate to pathogenicity.

  • Host-pathogen interaction studies: Investigate how AIM14 may influence interactions with host immune cells or tissues, potentially affecting immune evasion or tissue invasion.

  • Antifungal resistance correlations: Examine potential relationships between AIM14 expression or activity and resistance to conventional antifungals.

  • Biofilm formation: Study the role of AIM14 in biofilm formation, which is a significant virulence factor for C. tropicalis .

  • Metal homeostasis networks: As a probable metalloreductase, AIM14 likely participates in metal homeostasis pathways that may contribute to survival in the host environment. Integrating findings about AIM14 with knowledge of these pathways could provide insights into novel therapeutic targets.

What statistical approaches are most appropriate for analyzing sensitivity and specificity data in Candida detection methods?

For analyzing sensitivity and specificity data in Candida detection methods, several statistical approaches are appropriate:

In the evaluation of M1-mRAP, statistical comparisons with conventional qPCR showed consistency between the methods (P<0.05), while M1-mRAP demonstrated superior clinical detection capabilities, identifying samples in the qPCR grey zone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.