Recombinant Canine coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Canine Coronavirus Membrane Protein (M)

The membrane (M) protein of canine coronavirus (CCoV) is a significant structural component of the virus . It is the most abundant structural protein and spans the membrane bilayer three times, with a short NH2-terminal domain outside the virus and a long COOH terminus inside the virion . The M protein plays a crucial role in virus assembly and budding, although its precise function is not fully understood . Recombinant M protein (rMP) refers to the M protein that has been cloned and expressed in a system outside of the virus's natural host, often in E. coli . The recombinant form of the protein maintains the antigenicity of the natural protein and is useful for research and diagnostic applications .

Significance of M Protein in Canine Coronavirus

The M protein is a key component of CCoV due to its involvement in virus assembly and its ability to induce antibody-dependent, complement-mediated virus neutralization . After CCoV infection, antibodies to the M protein are consistently detected in seropositive dogs, making it a reliable marker for diagnostic assays .

Production and Purification of Recombinant M Protein

The production of recombinant M protein typically involves cloning the gene encoding the M protein from a CCoV strain and expressing it in a bacterial system such as E. coli . The coding region for the M protein is amplified using PCR with specific primers designed to target the M protein gene . After amplification, the PCR product is inserted into an expression plasmid and transformed into E. coli for protein production . The recombinant M protein is then purified using methods such as nickel-affinity column and size exclusion chromatography to achieve high purity .

Applications of Recombinant M Protein

Recombinant M protein has several important applications, particularly in the diagnosis of CCoV infection. It can be used in enzyme-linked immunosorbent assays (ELISA) to detect CCoV antibodies in dog sera . An ELISA based on recombinant M protein offers an alternative and valid test for detecting antibodies to CCoV in dog sera . The use of rMP in ELISA provides several advantages over using whole virus antigens, including ease of preparation, standardization, and the ability to produce large quantities of the protein .

ELISA Test with Recombinant M Protein

An ELISA test using recombinant M protein is developed to detect antibodies to CCoV in dog sera . In this test, the recombinant M protein is used as the antigen to capture antibodies present in the serum samples . The ELISA test's performance is evaluated by comparing it with whole virus ELISA and Western blotting, with the rMP-based ELISA showing excellent correlation with these assays . The cut-off value for the ELISA is determined using negative control sera to ensure accurate results .

Advantages of Recombinant M Protein-Based ELISA

The recombinant M protein-based ELISA offers several advantages for detecting CCoV antibodies:

  1. High Sensitivity and Specificity: The rMP-based ELISA correlates well with whole virus ELISA and Western blotting, providing reliable results .

  2. Ease of Preparation and Standardization: High levels of M protein expression in E. coli make the rMP-based ELISA easy to prepare and standardize .

  3. Large-Scale Production: The availability of large amounts of CCoV rMP allows for better investigation of the biological properties and immunological role of the M protein during CCoV infection .

  4. Consistent Results: Unlike whole virus antigens, which may yield variable results depending on the preparation method, recombinant M protein provides consistent and reproducible results .

Limitations and Future Directions

While recombinant M protein-based ELISA is a valuable tool, there are some limitations to consider. The test's performance can be affected by the quality of the recombinant protein and the optimization of the ELISA protocol. Future research could focus on improving the sensitivity and specificity of the ELISA, as well as exploring the use of recombinant M protein in other diagnostic assays, such as lateral flow assays. Further studies are needed to fully understand the biological properties of the M protein and its role in CCoV infection.

Canine Coronavirus Overview

Canine coronavirus (CCoV) is an alphacoronavirus that infects dogs, closely related to enteric coronaviruses found in cats and pigs . CCoV can be categorized into two main pathotypes: canine enteric coronavirus (CECoV) and canine respiratory coronavirus (CRCoV) . CECoV primarily causes enteric infections, while CRCoV is associated with respiratory disease . In some instances, CCoV has been detected in patients with pneumonia, suggesting the potential for novel recombinant strains to emerge .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-262
Protein Length
Full Length of Mature Protein
Species
Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)
Target Names
M
Target Protein Sequence
ENYCAMNSTAQTSCLISGSVCALCFEGGDLVWHLANWNFSWSVILIVFITVLQYGRPQFS WFVYGVKMLIMWLLWPIVLALTIFNAYSEYEVSRYVMFGFSVAGAIVTFILWIMYFVRSI QLYRRTKSWWSFNPETNAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKQLKASSATGWAYYVKSKAGDYSTDARTDTLSEHEK LLHMV
Uniprot No.

Target Background

Function

A component of the viral envelope crucial for virus morphogenesis and assembly through interactions with other viral proteins.

Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the canine coronavirus M protein?

The membrane (M) glycoprotein is the most abundant structural protein in canine coronavirus. It spans the membrane bilayer three times, with a short NH2-terminal domain positioned outside the virus and a long COOH terminus inside the virion . The M protein consists of 264 amino acids with three N-glycosylated residues in most CCoV strains, though some variants like CCoV-II isolate BGF10 exhibit only two glycosylated asparagine residues .

Functionally, the M protein plays a crucial role in virus assembly and budding during viral replication . Additionally, studies have demonstrated that the M protein induces antibody-dependent complement-mediated virus neutralization, indicating its importance in the host immune response .

How is recombinant CCoV M protein typically expressed in laboratory settings?

The recombinant expression of CCoV M protein typically employs an E. coli expression system. The methodological approach involves:

  • RNA isolation from CCoV-infected tissue samples

  • Reverse transcription to generate cDNA

  • PCR amplification of the M protein coding region using specific primers containing appropriate restriction sites (e.g., BamHI and HindIII)

  • Cloning of the amplified product into an expression vector (e.g., pQE30)

  • Transformation into competent E. coli cells (e.g., TOP10F)

  • Screening of transformants using colony PCR and restriction digestion

  • Verification through sequencing

Following successful cloning, expression is induced using IPTG, resulting in the production of a recombinant protein with an N-terminal polyhistidine tag. The expressed protein typically forms inclusion bodies in the bacterial cytosol and appears as a ~30kDa band on SDS-PAGE gels after purification .

What are the advantages of using recombinant M protein over whole virus preparations for serological testing?

Using recombinant M protein for CCoV antibody detection offers several methodological advantages over whole virus preparations:

  • Standardization: The E. coli expression system allows for consistent production of large quantities of M protein, making the rMP-based ELISA easier to standardize .

  • Reproducibility: The recombinant protein production process is more controlled than preparing antigen from CCoV-infected cells, which may yield variable results depending on preparation methods .

  • Specificity: Studies have shown excellent correlation between rMP-based ELISA and traditional methods (whole virus ELISA and Western blotting), indicating comparable specificity and sensitivity .

  • Safety: Working with recombinant proteins eliminates the need to propagate infectious virus, reducing biosafety concerns.

  • Accessibility: High-level expression in bacterial systems makes the antigen more readily available for research and diagnostic applications .

How do recombination events in the CCoV genome affect M protein structure and function?

Recombination is a significant evolutionary mechanism in coronaviruses, including CCoV. While the M protein itself remains relatively conserved compared to the spike protein, recombination events elsewhere in the genome can indirectly affect M protein functionality.

Research has identified distinct CCoV variants like CCoV-A76, which possesses a recombinant spike protein resulting from recombination between type I and type II CCoV . These recombination events primarily occur between the N- and C-terminal domains of the S1 subunit, leading to altered receptor usage and host cell tropism . While not directly modifying the M protein sequence, these changes can impact how the M protein interacts with other viral components during assembly and how antibodies against the M protein might neutralize different variants.

Methodologically, researchers investigating recombination effects should:

  • Perform comparative sequence analysis of M proteins across various CCoV isolates

  • Analyze potential coevolution between M and other structural proteins

  • Evaluate antibody cross-reactivity against M proteins from different recombinant variants

  • Assess whether recombination events alter M protein glycosylation patterns, which may affect immunogenicity

What methodologies are most effective for purifying recombinant CCoV M protein while maintaining structural integrity?

Purification of recombinant CCoV M protein presents challenges due to its membrane-associated nature. Based on research protocols, the following methodological approach has proven effective:

  • Harvest bacterial cells after IPTG induction (optimal time: 5 hours post-induction)

  • Resuspend cell pellet in buffer containing 50 mM phosphate buffer (pH 7.8), 300 mM NaCl

  • Add lysozyme (100 μg/ml) and incubate for 30 minutes at room temperature

  • Disrupt cells by sonication (six 10-second bursts at 200–300 W)

  • Add detergent (1% Triton X-100) to solubilize membrane components

  • Separate inclusion bodies by centrifugation (15 minutes at 4°C)

  • For further purification, employ gel electrophoresis followed by electroelution to eliminate bacterial contaminants

To verify protein integrity post-purification, researchers should:

  • Confirm the N-terminal sequence through sequencing

  • Assess antigenicity via Western blotting using monoclonal antibodies against the M protein

  • Evaluate functionality through antibody detection assays comparing with native protein

How can researchers optimize ELISA protocols using recombinant M protein for maximum sensitivity and specificity?

Optimizing ELISA protocols using recombinant M protein requires systematic evaluation of multiple parameters. Based on published methodologies, researchers should:

  • Determine optimal antigen concentration through checkerboard titration:

    • Test serial dilutions of rMP (5-200 ng/well) against 2-fold dilutions of known positive and negative sera

    • The optimal concentration reported is approximately 100 ng/well

  • Establish appropriate serum dilutions:

    • Test dilutions ranging from 1:50 to 1:400 to determine the optimal signal-to-noise ratio

    • Select dilutions that provide clear differentiation between positive and negative samples

  • Calculate appropriate cut-off values:

    • Use negative control sera (n≥15) to establish baseline readings

    • Calculate the mean optical density (OD) plus 3 standard deviations as a reliable cut-off

    • In published protocols, with 16 negative sera yielding mean OD 0.017 ± 0.00325, the cut-off was set at 0.027

  • Validate assay performance:

    • Compare results with established methods (whole virus ELISA, Western blotting)

    • Determine sensitivity and specificity using well-characterized sample panels

    • Evaluate reproducibility through intra- and inter-assay coefficient of variation analysis

What controls should be included when expressing and validating recombinant CCoV M protein?

Proper experimental controls are critical for reliable expression and validation of recombinant CCoV M protein. A comprehensive control strategy should include:

For expression:

  • Pre-induction culture samples to establish baseline protein expression

  • Non-transformed E. coli cultures (negative control)

  • Vector-only transformed cultures (to identify any vector-derived protein expression)

  • Time-course sampling post-induction to determine optimal expression time

  • Comparison of different expression conditions (temperature, IPTG concentration)

For protein validation:

  • Western blotting controls:

    • Anti-His tag monoclonal antibody (to confirm tag presence)

    • Anti-CCoV M protein monoclonal antibody (to confirm identity)

    • Known CCoV-positive canine serum (to confirm antigenicity)

    • Known CCoV-negative canine serum (to assess specificity)

  • ELISA validation controls:

    • Positive and negative reference sera (previously characterized by multiple methods)

    • Heterologous coronavirus antisera (to assess cross-reactivity)

    • Background controls (wells without antigen but with all other reagents)

    • Blanks (buffer only)

How can researchers differentiate between antibody responses to different CCoV serotypes using recombinant M proteins?

Differentiating antibody responses to CCoV serotypes requires careful design of serotype-specific assays utilizing recombinant M proteins. The methodological approach should include:

  • Expression of recombinant M proteins from different CCoV serotypes (type I and type II) and variants such as CCoV-A76

  • Sequence comparison and epitope mapping:

    • Analyze sequence differences between M proteins from different serotypes

    • Identify serotype-specific epitopes through computational prediction and experimental validation

    • Generate peptides representing unique epitopes for each serotype

  • Development of differential assays:

    • Competitive ELISA using serotype-specific recombinant M proteins

    • Two-step ELISA with sequential absorption using different serotype antigens

    • Multiplex assays simultaneously detecting antibodies against different serotypes

  • Validation using well-characterized sera:

    • Test samples from animals experimentally infected with known serotypes

    • Analyze cross-reactivity patterns

    • Establish algorithms for interpreting differential responses

This approach enables researchers to accurately classify antibody responses, which is particularly important when studying areas where multiple CCoV serotypes circulate or when investigating recombinant variants like CCoV-A76 that show distinct serological properties .

How can recombinant M protein be used to track the evolution of circulating CCoV variants?

Recombinant M protein serves as a valuable tool for tracking CCoV evolution and variant emergence through several methodological approaches:

  • Sequence-based surveillance:

    • Clone and express M proteins from different temporal and geographical isolates

    • Compare amino acid substitutions, particularly at glycosylation sites

    • Correlate changes with outbreak patterns or emerging clinical presentations

  • Antigenic cartography:

    • Use recombinant M proteins from different variants in serological assays

    • Map antigenic relationships between variants based on antibody cross-reactivity

    • Identify antigenic drift in the M protein over time

  • Functional evolution analysis:

    • Assess whether M protein changes correlate with altered virulence or transmissibility

    • Investigate if variants show differential interaction with host cellular components

    • Evaluate if evolutionary changes affect diagnostic test performance

Recent research has identified emerging variants of canine enteric coronavirus (CECoV) associated with severe gastroenteritis outbreaks. M gene sequence analysis has been effectively used to track the geographical circulation of these variants, demonstrating its utility as a molecular marker for evolutionary studies .

What are the methodological approaches to study interactions between recombinant M protein and other viral proteins in coronavirus assembly?

Studying M protein interactions during coronavirus assembly requires sophisticated methodological approaches:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation using recombinant M protein and other viral proteins

    • Yeast two-hybrid screening to identify interaction partners

    • Bimolecular fluorescence complementation to visualize interactions in living cells

    • Surface plasmon resonance to determine binding kinetics

  • Structural biology approaches:

    • Cryo-electron microscopy of virus-like particles containing recombinant M protein

    • X-ray crystallography of M protein complexes with interaction partners

    • Nuclear magnetic resonance spectroscopy for dynamic interaction analysis

  • Functional disruption studies:

    • Site-directed mutagenesis of key residues in the M protein

    • Expression of truncated M protein variants to map interaction domains

    • Competitive inhibition assays using M protein-derived peptides

  • Visualization techniques:

    • Confocal microscopy with fluorescently-tagged M protein and partners

    • Super-resolution microscopy to resolve subcellular localization during assembly

    • Live-cell imaging to track M protein trafficking

These approaches provide insights into how the M protein coordinates with other viral components during the assembly process, particularly its interactions with the E protein and nucleocapsid during virion formation.

How does the glycosylation pattern of recombinant M protein affect its utility in diagnostic applications?

The glycosylation pattern of recombinant M protein significantly impacts its diagnostic utility through several mechanisms:

  • Native vs. recombinant glycosylation differences:

    • The CCoV M protein naturally contains three N-glycosylation sites

    • E. coli-expressed recombinant proteins lack glycosylation, which may affect epitope presentation

    • Researchers must consider whether key antibody-binding epitopes depend on glycan structures

  • Methodological approaches to address glycosylation issues:

    • Expression in eukaryotic systems (insect cells, yeast, mammalian cells) to preserve glycosylation

    • Comparison of antibody binding to glycosylated vs. non-glycosylated recombinant M proteins

    • Enzymatic addition of glycans to E. coli-expressed proteins

  • Diagnostic performance considerations:

    • Evaluate whether lack of glycosylation affects sensitivity for detecting early antibody responses

    • Assess if non-glycosylated recombinant M protein fails to detect antibodies targeting glycan-dependent epitopes

    • Consider incorporating both glycosylated and non-glycosylated forms in diagnostic platforms

What methodological approaches can differentiate between vaccine-induced and infection-induced antibodies to the M protein?

Differentiating between vaccine-induced and infection-induced antibodies to the M protein requires sophisticated methodological approaches:

  • Epitope-specific assays:

    • Identify epitopes uniquely presented during natural infection but not vaccination

    • Develop peptide arrays covering the entire M protein sequence

    • Screen sera from vaccinated and naturally infected animals to identify differential epitope recognition

  • Antibody kinetics analysis:

    • Monitor the development and waning of antibodies to different proteins over time

    • Compare IgM:IgG ratios between vaccinated and infected animals

    • Evaluate antibody avidity maturation patterns, which often differ between vaccination and infection

  • Multiplex protein assays:

    • Combine recombinant M protein with other viral proteins (N, S, E)

    • Analyze antibody profiles against multiple proteins simultaneously

    • Use pattern recognition algorithms to classify antibody signatures

  • Competitive binding assays:

    • Develop assays where distinguishing epitopes compete for antibody binding

    • Use labeled reference antibodies with known binding properties

    • Measure displacement by test sera to characterize antibody specificities

These approaches enable researchers to develop diagnostic strategies that can differentiate vaccination status from natural infection, which is particularly important for epidemiological studies and in scenarios where vaccination history is unknown.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.