Recombinant Canine coronavirus Non-structural protein 3b (3b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your preferred tag type during ordering to prioritize its inclusion.
Synonyms
3b; Non-structural protein 3b; ns3b; Accessory protein 3b; Protein X2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)
Target Names
3b
Target Protein Sequence
MIGGLFLNTLSFVIVSNHVVNNTANVHHIQQEHVIVQQTQIVSARTQNYYPEFSIAVLFV SFLALYRSTNFKTCVGILMFKIVSMTLIGPMLTAYGYYIDGIVTTTVLALRFIYLSYFWY VNNRFEFVLYNTTTLMFVHGRAAPFMRSSHSSIYVTLYGGINYMFVNDLTLHFVDPMLVS IAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEVEDHVY DVPSGINCHR
Uniprot No.

Target Background

Function
Potential virulence factor.
Protein Families
Coronaviruses NS3b protein family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is canine coronavirus non-structural protein 3b and what is its significance in viral pathogenicity?

Non-structural protein 3b (nsp 3b) is a viral accessory protein encoded by canine coronavirus that has been associated with virulence in coronaviruses. The full-length nsp 3b protein consists of 250 amino acids in virulent strains, while attenuated strains like Insavc-1 possess a truncated form of only 171 amino acids . This truncation has been consistently associated with attenuation in multiple survey studies .

The role of nsp 3b appears to be particularly significant in the context of viral dissemination. While the precise mechanisms remain under investigation, evidence suggests that increased amounts of full-length nsp 3b protein may be partially responsible for enhanced virulence in certain CCoV strains . This correlation between protein structure and pathogenicity provides a potential molecular marker for distinguishing between virulent and attenuated strains.

How are canine coronavirus strains classified, and what distinguishes recombinant variants?

Canine coronavirus strains are classified into two major genotypes:

  • CCoV type I

  • CCoV type II

CCoV type II is further divided into two subtypes:

  • CCoV-IIa: "Classical" CCoV type II strains

  • CCoV-IIb: Recombinant strains of potential recombinant origin with transmissible gastroenteritis virus (TGEV)

What methods are used to detect and differentiate between CCoV subtypes in research settings?

The detection and differentiation of CCoV subtypes rely primarily on molecular techniques:

  • Nested PCR assay: For initial detection of CCoV viral RNA in various tissues and samples.

  • Genotype-specific real-time RT-PCR assays: For distinguishing CCoV-I from CCoV-II and quantifying viral loads.

  • Subtype-specific PCR: For differentiating between CCoV-IIa and CCoV-IIb subtypes.

  • Virus isolation: Isolation on cell cultures (e.g., A-72 cells) followed by observation of cytopathic effects.

  • Immunofluorescence assay: For confirmation of viral presence in cell cultures .

Viral quantification is typically performed using real-time RT-PCR assays that can determine viral RNA copies in various tissues, as exemplified in the following data from two infected puppies:

Sample66/09 (Yorkshire Terrier)68/09 (Pomeranian)
Faeces3.59 × 10³7.22 × 10⁵
Liver4.64 × 10⁴3.21 × 10⁵
Spleen5.20 × 10⁵1.55 × 10⁷
Pancreas2.75 × 10²2.03 × 10⁴
Kidney1.23 × 10⁵3.37 × 10⁶
Lung5.99 × 10⁶4.10 × 10⁶
Heart1.14 × 10⁵7.08 × 10⁶
Brainn.d.2.47 × 10³

n.d., not detected

What molecular mechanisms underlie recombination events between CCoV and TGEV?

Recombination events between coronaviruses, specifically between CCoV and TGEV, occur through homologous RNA recombination, which is a major driver of genetic evolution and diversity in the Coronaviridae family . For recombination to occur, several conditions must be met:

  • Co-infection requirement: Mixed infections with both viruses are necessary for recombination events to occur in field conditions .

  • Receptor compatibility: Experimental evidence suggests that feline aminopeptidase N serves as a functional receptor for both CCoV and TGEV, allowing both viruses to potentially infect the same cells .

  • Cross-species potential: Experimental infections have demonstrated that piglets can be infected with CCoV and dogs with TGEV, suggesting a biological basis for cross-species viral exchange .

The exact host in which recombination occurs naturally remains unknown, though these experimental findings establish the biological plausibility of such events. The first indication of a recombinant CCoV strain with TGEV (UCD-1) was identified in the late 1990s . Subsequently, TGEV-like strains were reported circulating in dogs across different European countries, classified as the CCoV-IIb subtype .

What experimental approaches are recommended for studying the functional role of nsp 3b in coronavirus pathogenesis?

To effectively study the functional role of nsp 3b in coronavirus pathogenesis, researchers should consider the following experimental approaches:

  • Reverse genetics systems: Developing and utilizing reverse genetics platforms to generate recombinant viruses with specific modifications to the nsp 3b gene. This allows for direct comparison of viruses that differ only in their nsp 3b region.

  • In vitro tissue culture models: Comparing the replication kinetics, cellular tropism, and cytopathic effects of viruses with full-length versus truncated nsp 3b in various cell lines.

  • Ex vivo organ cultures: Using organ culture systems to assess tissue tropism differences between CCoV strains with different nsp 3b variants.

  • Controlled animal infections: Conducting experimental infections in dogs using reverse-engineered viruses that differ only in their nsp 3b region to directly assess the impact on viral pathogenicity and tissue distribution.

  • Quantitative tissue distribution analysis: Implementing real-time RT-PCR approaches similar to those used in previous studies to quantify viral loads across multiple tissues, as demonstrated in the data table showing viral distribution in infected puppies .

  • Co-infection models: Establishing experimental models that incorporate co-infection with CPV-2, which appears to facilitate the systemic spread of CCoV-IIb strains .

How do deletions in the intergenic S-3a region potentially affect nsp 3b expression and function?

Deletions of 61-64 bp in the intergenic S-3a region have been identified in virulent CCoV variants . These deletions may significantly impact nsp 3b expression and function through several mechanisms:

  • Transcription regulatory sequence modifications: The length and composition of transcription regulatory sequences directly influence the efficiency of transcription and translation in coronaviruses. Studies with TGEV have demonstrated this relationship .

  • Enhanced translation efficiency: Deletions in this region have been associated with increased translation levels of nsp 3b, potentially leading to higher concentrations of the protein during infection .

  • Parallel observations in related viruses: Similar deletions have been documented in virulent TGEV variants, suggesting a conserved mechanism that enhances virulence across related coronaviruses .

  • Regulatory RNA structure alterations: Deletions may modify RNA secondary structures that regulate the accessibility of the translation machinery to the nsp 3b coding sequence.

Understanding these mechanisms requires detailed molecular analysis combining RNA structure predictions, translation efficiency measurements, and correlations with virulence in animal models. The consistency of these deletions across multiple virulent isolates strongly suggests functional significance rather than random mutation events.

What is known about the interaction between recombinant CCoV strains and host immune responses?

  • M protein variations: The BGF strain of CCoV (containing full-length nsp 3b) exhibits a highly divergent region at the amino terminal domain of the membrane protein that may be implicated in avoiding host immune reactions .

  • Systemic dissemination patterns: The ability of CCoV-IIb strains to spread beyond the intestinal tract to multiple organs suggests mechanisms for evading local immune containment .

  • Co-infection immune modulation: The observation that CCoV-IIb strains with full-length nsp 3b primarily disseminate to organs in dogs co-infected with CPV-2 suggests potential immune modulation during co-infection that facilitates viral spread .

  • Strain-specific tissue distribution: The distinct tissue distribution patterns between CCoV-IIa (restricted to intestinal content) and CCoV-IIb (found in multiple organs) suggests differences in their interactions with tissue-specific immune mechanisms .

The presence of CCoV-IIb strains in multiple organs, including immunologically privileged sites like the brain in some cases, indicates potential mechanisms for immune evasion or modulation that facilitate systemic spread . These observations highlight the need for comprehensive immunological studies comparing host responses to different CCoV subtypes.

How do recombination events in canine coronaviruses compare to those observed in other coronavirus species?

Recombination events in canine coronaviruses share several features with those observed in other coronavirus species, while also displaying distinctive characteristics:

  • Common evolutionary mechanism: Homologous RNA recombination serves as a major driver of genetic evolution and diversity across the Coronaviridae family, as observed in canine, feline, porcine, and human coronaviruses . The recent discovery of SARS-CoV-2 recombination events in immunocompromised patients demonstrates the conservation of this evolutionary mechanism across distantly related coronaviruses .

  • Interspecies recombination potential: The recombination between CCoV and TGEV reflects the potential for interspecies genetic exchange, similar to recombination events documented between different coronavirus strains infecting humans, such as the Delta and Omicron BA.5 variants of SARS-CoV-2 .

  • Impact on tissue tropism: The association between recombination in the S gene region and altered tissue tropism observed in CCoV-IIb strains parallels observations in other coronaviruses, where S protein mutations mediate receptor attachment and tissue tropism shifts .

  • Immunocompromised hosts as recombination sites: While CCoV recombination has been observed in the field, the specific identification of SARS-CoV-2 recombination in immunocompromised patients provides a potential model for understanding the conditions that facilitate coronavirus recombination events .

  • Viral persistence requirements: Both canine coronavirus and SARS-CoV-2 recombination events appear to require sustained viral replication, either through mixed infections or long-term persistence in immunocompromised hosts .

These parallels suggest conserved mechanisms driving coronavirus evolution across different host species, with implications for understanding the emergence of novel coronavirus variants with altered pathogenicity or host range.

What methodological considerations are important when investigating non-structural proteins in recombinant coronaviruses?

When investigating non-structural proteins in recombinant coronaviruses, researchers should consider several methodological approaches and potential pitfalls:

  • Comprehensive genetic analysis: Complete genomic sequencing is essential for accurate identification of recombination breakpoints and characterization of non-structural protein genes. Partial sequence analysis may miss complex recombination patterns .

  • Phylogenetic assessment: Robust phylogenetic analysis across multiple genomic regions is necessary to confirm recombination events and distinguish them from convergent evolution .

  • Quantitative tissue distribution analysis: Implementing sensitive quantitative PCR methodologies to accurately measure viral loads across multiple tissues is crucial for understanding the relationship between non-structural proteins and tissue tropism .

  • Controlled functional studies: When attributing functions to non-structural proteins, controlled experiments with appropriate attenuated strains as comparisons are essential. The absence of such controls can lead to difficult-to-interpret results, as noted in studies of topoisomerase 3b's role in coronavirus replication .

  • Co-infection considerations: Experimental models should account for the potential impact of co-infecting pathogens, as these may significantly influence the behavior of recombinant coronavirus strains. The case of CPV-2 co-infection facilitating CCoV-IIb dissemination illustrates this importance .

  • Cell culture validation: Findings from cell culture systems should be validated in animal models when possible, as the role of non-structural proteins may differ between in vitro and in vivo contexts .

  • Strain variation awareness: Researchers must account for strain-specific variations when generalizing findings about non-structural proteins. As demonstrated with topoisomerase 3b, effects observed with some coronavirus strains may not universally apply to others .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.