Recombinant Canine distemper virus Hemagglutinin glycoprotein (H)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Canine Distemper Virus Hemagglutinin Glycoprotein (H)

Canine distemper virus (CDV) is a member of the Paramyxoviridae family and a significant multi-host pathogen that causes a contagious disease affecting multiple systems, including the respiratory, gastrointestinal, and neurological systems . The hemagglutinin (H) glycoprotein is a crucial component of the CDV envelope . It mediates the attachment of the virus to the host cell by binding to cellular receptors, which initiates the infection process . The H protein then triggers the fusion of the viral envelope with the host cell membrane .

Structure and Function of H Protein

The CDV H protein is a type II glycoprotein consisting of approximately 607 amino acids with a molecular weight of about 78 kD . It includes:

  • An N-terminal cytosolic tail (amino acids 1-35)

  • A single-pass transmembrane domain (amino acids 36-58)

  • An ectodomain (amino acids 59-604 or 607) comprised of :

    • A membrane-proximal stalk region (amino acids 59-154)

    • A connecting region (amino acids 155-187)

    • A membrane-distal head domain (amino acids 188-604 or 607) with six $$\beta$$-sheets arranged in a six-bladed propeller fold .

Two head monomers are linked by disulfide bonds at Cys139 and Cys154, forming a homodimer that further assembles into a tetrameric structure .

Role in Viral Infection

The H glycoprotein is essential for CDV's pathogenicity. It facilitates the initial binding of the virus to the host cell membrane . After binding, the H protein induces a conformational change that leads to the fusion of the viral and cellular membranes, allowing the viral ribonucleoprotein (RNP) to enter the host cell's cytoplasm . The H protein is a major target for neutralizing antibodies, which can prevent the virus from binding to host cells or interfere with its interaction with the fusion (F) protein, thus inhibiting membrane fusion .

Antigenic Properties and Epitopes

The H protein exhibits antigenic variability among different CDV strains . Neutralizing monoclonal antibodies (mAbs) can target specific epitopes on the H protein, offering insights into virus neutralization mechanisms . For example, a neutralizing mAb called 2D12 was found to target a linear epitope (238DIEREFD244) on the H protein . This epitope is highly conserved in the America-1 vaccine lineage of CDV strains but shows substitutions in other lineages, affecting its antigenicity . The identified epitope is located on the surface of the H protein but not at the receptor-binding site (RBS). The 2D12 mAb does not inhibit the binding of the H protein to the receptor; instead, it interferes with the H-F protein interaction, which inhibits membrane fusion .

Glycosylation of H Protein

The H proteins of paramyxoviruses are modified by N-linked glycans, which are important for correct folding, processing, and cell surface expression . CDV H proteins have multiple potential N-glycosylation sites, with at least three sites conserved across all strains . The glycosylation pattern affects the virus's virulence. Recombinant viruses expressing N-glycan-deficient H proteins are less likely to cause disease, even if their immunosuppressive capacities are retained .

Use in Diagnostic Assays

The H protein's hydrophilic extra-viral domain (HEVD) can be used to develop enzyme-linked immunosorbent assays (ELISAs) for detecting antibodies against CDV . An ELISA using the HEVD protein as an antigen can effectively measure serum antibody levels in dogs, which helps assess the effectiveness of CDV vaccines .

H Protein as a Determinant of Viral Tropism

The H protein is a primary determinant of viral tropism, influencing the virus's ability to infect specific cell types and cause disease . Recombinant viruses with different H proteins exhibit varying fusion efficiencies and growth characteristics . The H protein determines the extent of cell-cell fusion during viral infection .

Differentiation of Wild-Type and Vaccine Strains

Due to sequence differences between wild-type and vaccine strains of CDV, the H gene can be used to differentiate between them using molecular methods such as reverse transcription-polymerase chain reaction (RT-PCR) . Specific primers can be designed to amplify regions of the H gene that are unique to either wild-type or vaccine strains, allowing for the detection and differentiation of these strains in clinical samples .

Impact of H Protein on Cross-Species Infections

CDV has a broad host range and can infect various species, including non-human primates . The H protein plays a role in determining the virus's ability to infect different species . Understanding the structural and functional characteristics of the H protein is crucial for developing strategies to control and prevent CDV infections in multiple host species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
H; Hemagglutinin glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Canine distemper virus (strain Onderstepoort) (CDV)
Target Names
H
Target Protein Sequence
MLPYQDKVGAFYKDNARANSTKLSLVTEGHGGRRPPYLLFVLLILLVGILALLAITGVRF HQVSTSNMEFSRLLKEDMEKSEAVHHQVIDVLTPLFKIIGDEIGLRLPQKLNEIKQFILQ KTNFFNPNREFDFRDLHWCINPPSTVKVNFTNYCESIGIRKAIASAANPILLSALSGGRG DIFPPHRCSGATTSVGKVFPLSVSLSMSLISRTSEVINMLTAISDGVYGKTYLLVPDDIE REFDTREIRVFEIGFIKRWLNDMPLLQTTNYMVLPKNSKAKVCTIAVGELTLASLCVEES TVLLYHDSSGSQDGILVVTLGIFWATPMDHIEEVIPVAHPSMKKIHITNHRGFIKDSIAT WMVPALASEKQEEQKGCLESACQRKTYPMCNQASWEPFGGRQLPSYGRLTLPLDASVDLQ LNISFTYGPVILNGDGMDYYESPLLNSGWLTIPPKDGTISGLINKAGRGDQFTVLPHVLT FAPRESSGNCYLPIQTSQIRDRDVLIESNIVVLPTQSIRYVIATYDISRSDHAIVYYVYD PIRTISYTHPFRLTTKGRPDFLRIECFVWDDNLWCHQFYRFEADIANSTTSVENLVRIRF SCNR
Uniprot No.

Target Background

Function
This hemagglutinin (H) glycoprotein mediates viral attachment to cell receptors, initiating infection. H protein binding to the receptor induces a conformational change, enabling the fusion (F) protein to trigger membrane fusion between the virion and the cell. The cellular receptor may be SLAM, potentially explaining the virus's lymphotropism.
Gene References Into Functions
  1. This study supports a binding model between the Canine Distemper Virus (CDV) attachment protein and the V domain of CD150/SLAM, highlighting the role of SLAM residue E123 in activating the fusion mechanism. PMID: 26608324
  2. Data suggest that H binds to the F globular head domain laterally. PMID: 25355896
  3. Different N-linked glycosylation sites were identified in the F and H genes of six isolates from the prototype vaccine strain. PMID: 23624803
  4. Research indicates that a restricted region on one side of the CDV H protein contains distinct, overlapping sites that regulate functional interactions with multiple receptors. PMID: 21849439
  5. This study shows that three key residues in the virulent CDV A75/17 H protein (Y525, D526, and R529) control SLAM-binding activity without significantly affecting protein surface expression or SLAM-independent F triggering. PMID: 20631152
  6. Findings demonstrate that recombinant viruses expressing N-glycan-deficient H proteins lose their pathogenicity, while retaining immunosuppressive capabilities, suggesting that reduced N-glycosylation affects attenuation without impacting immunosuppression. PMID: 20042514
  7. At least three distinct CDV genotypes, distantly related to vaccine strains (Onderstepoort-like, America-1 genotype), are currently circulating in foxes, raccoon dogs, and minks in China, with Asia-1 being predominant. PMID: 19647380
  8. Susceptibility to CD9 antibodies correlates with the H protein; the complete extracellular domain, including the stem and globular head, mediates this effect. PMID: 16690928
Database Links

KEGG: vg:1489792

Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family, Non-sialidase subfamily
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.

Q&A

What is the role of the Hemagglutinin (H) protein in Canine Distemper Virus infection?

The Hemagglutinin (H) glycoprotein plays a critical role in CDV infection by mediating attachment of the virus to cell receptors, primarily the signaling lymphocyte activation molecule (SLAM; CD150) expressed on activated T and B cells. Upon binding, the H protein undergoes a conformational change that signals the Fusion (F) protein to trigger membrane fusion between the viral and host cell membranes, enabling viral entry. Additionally, the H protein has been shown to down-regulate surface expression of certain cellular proteins like human MCP/CD47, contributing to immune evasion mechanisms . Research has demonstrated that the H protein is the primary determinant of fusion efficiency, viral tropism, and pathogenesis, making it a critical target for both diagnostic and therapeutic development .

How do N-glycosylation patterns affect the function of CDV H protein?

N-glycosylation of CDV H protein significantly impacts viral function and pathogenesis through multiple mechanisms:

  • Protein Expression and Transport: N-glycosylation affects proper folding and transport of the H protein to the cell surface. Studies have shown that recombinant viruses with deglycosylated H proteins demonstrate reduced expression levels compared to wild-type .

  • Virulence Modulation: Wild-type CDV strains contain up to 8 potential N-glycosylation sites, with 3 sites conserved across all strains and 2-5 additional sites in wild-type strains. Research has demonstrated that a wild-type virus with an H protein reproducing the vaccine strain N-glycosylation pattern remained lethal in ferrets but with a prolonged disease course .

  • Attenuation without Immunosuppression: Recombinant viruses expressing N-glycan-deficient H proteins no longer caused disease in experimental models, even though their immunosuppressive capacities were retained. This indicates that reduced N-glycosylation contributes to attenuation without affecting immunosuppression .

  • Minimal Requirements: Contrary to observations in other paramyxoviruses, CDV H protein can remain fully functional even without N-glycans, though minimal N-glycosylation is required for virulence in vivo .

Recombinant Expression and Purification Methods

Developing effective deletion mutants of CDV H protein for diagnostics requires strategic selection of regions that maintain antigenic properties while optimizing expression. Based on research findings:

  • Identify conserved antigenic regions: Sequence analysis of multiple CDV strains is essential to identify conserved epitopes that will detect diverse field isolates. Comparative genomics has revealed significant variations between vaccine and wild-type strains, with the H gene showing pronounced genetic diversity .

  • Design truncation strategies: Full-length H protein and deletion mutants can be produced in expression systems such as E. coli. Research has demonstrated that certain truncated recombinant proteins (designated HM3, HM4, and HM5) exhibited high expression levels while retaining antigenic properties .

  • Validate specificity and sensitivity: Using both negative and positive serum samples is crucial. In one study, truncated recombinant proteins were tested against three negative sera and 17 CD-positive sera, demonstrating high specificity in ELISA formats .

  • Confirm antigenic recognition: Immunoblotting should be performed to verify that purified recombinant proteins maintain antigenic properties recognized by sera from CD-suspected animals. This ensures the diagnostic potential of the constructs .

  • Consider regional strain variations: Research has shown that sequence variations occur in the H gene from field CDV strains that have been implicated in increasing incidence of canine distemper in certain regions .

How can reverse genetics systems be utilized to study H protein contributions to viral tropism?

Reverse genetics systems provide powerful tools for investigating H protein contributions to viral tropism through systematic manipulation of viral genomes:

  • System establishment: Develop a plasmid containing the full-length antigenomic sequence of a reference CDV strain (such as CDV Onderstepoort). This serves as the backbone for genetic modifications .

  • H gene substitution: Replace the original H gene with variants from different strains or create chimeric/mutated versions. Studies have successfully introduced H genes from wild-type isolates (e.g., CDV 5804), vaccine strains (e.g., Onderstepoort), and even heterologous viruses (e.g., Measles virus) into the CDV backbone .

  • Virus recovery: Transfect the recombinant plasmid along with helper plasmids encoding viral proteins (N, P, L) into suitable cell lines to recover infectious recombinant viruses. Verify recombinant virus identity through sequencing, Western blot analysis, and growth characteristics .

  • Functional characterization: Examine the recovered viruses for:

    • Fusogenicity (syncytia formation capacity)

    • Growth kinetics in different cell types

    • Cell tropism

    • In vivo pathogenesis in animal models (e.g., ferrets)

  • Comparative analysis: Compare properties of recombinant viruses with parental strains to determine the specific contribution of the H protein to observed phenotypic changes .

Research has demonstrated that the H protein primarily determines fusion efficiency, growth characteristics, and tropism regardless of the viral genetic background, highlighting its central role in viral pathogenesis .

What methodologies can assess the potential of CDV to cross species barriers through H protein adaptation?

Assessing CDV's potential to cross species barriers through H protein adaptation requires multifaceted experimental approaches:

  • Serial passaging and directed evolution:

    • Culture wild-type CDV (e.g., strain 5804PeH) in cells expressing receptor molecules from non-natural host species (e.g., Vero cells expressing human SLAM [Vero-hSLAM])

    • Perform successive passages followed by plaque cloning to select for adaptive mutations

    • Monitor for increased replication efficiency and cytopathic effects

  • Mutation identification and characterization:

    • Sequence the H gene of adapted viruses to identify specific mutations in the receptor-binding domain (RBD)

    • Analyze the structural implications of identified mutations (e.g., D540G mutation found to enhance cell-cell fusion activity in human SLAM-expressing cells)

    • Create recombinant viruses carrying the identified mutations to confirm their functional significance

  • Receptor interaction studies:

    • Perform binding assays between recombinant H proteins and soluble receptors from different species

    • Use surface plasmon resonance or similar techniques to quantify binding affinities

    • Analyze structural data to identify key residues at the receptor-protein interface

  • Ex vivo infection models:

    • Challenge primary cells from potential host species (e.g., human PBMCs) with adapted virus strains

    • Assess cellular tropism (e.g., preference for T lymphocytes)

    • Measure impacts on cell function (e.g., inhibition of lymphocyte proliferation)

  • In vivo transgenic models:

    • Generate or utilize transgenic mice expressing receptor molecules from potential host species

    • Challenge with adapted virus strains

    • Evaluate viral replication in different tissues (e.g., lymphoid tissues)

    • Monitor for viremia and clinical manifestations

Research has demonstrated that CDV can adapt to utilize human SLAM through specific mutations in the H protein, enabling infection of human immune cells and replication in transgenic mouse models, although this adaptation appears insufficient for complete host switching .

How can CDV H protein be engineered into effective nanoparticle vaccines?

Engineering CDV H protein into effective nanoparticle vaccines involves several critical steps:

  • Conformation stabilization: Generate recombinant CDV H tetramers by incorporating foreign tetramerization motifs like GCN4 at the C-terminal of the H protein. This approach helps maintain the native quaternary structure critical for proper antigen presentation .

  • Expression optimization: Utilize insect cell (sf9) expression systems with recombinant baculovirus vectors containing a signal peptide (e.g., from honeybee melittin) to facilitate protein secretion and purification. The construct should include a His-tag for affinity purification .

  • Nanoparticle assembly: Treat purified H protein tetramers with chemical crosslinkers such as Bis[sulfosuccinimidyl] (BS3) at optimized concentrations (e.g., 6 mM) to induce self-assembly into stable nanoparticles. The crosslinking reaction can be stopped with Tris-HCl (pH 8.0) .

  • Characterization: Verify nanoparticle formation through:

    • SDS-PAGE and Western blot analysis to confirm crosslinking

    • Dynamic light scattering to determine particle size distribution

    • Electron microscopy to visualize particle morphology

    • Functional binding assays to ensure retention of receptor recognition

  • Adjuvant selection: Consider incorporating molecular adjuvants such as flagellin to enhance mucosal immune responses. Research has shown that combining CDV H nanoparticles with flagellin significantly improves immune responses .

Studies have demonstrated that vaccination with these engineered nanoparticles elicits approximately 7-8 fold higher IgG antibody titers compared to soluble H protein and develops increased CDV-specific neutralizing antibody, providing a promising platform for next-generation CDV vaccines .

What immune parameters should be evaluated when testing novel CDV H protein-based vaccines?

Comprehensive evaluation of novel CDV H protein-based vaccines requires assessment of multiple immune parameters:

  • Humoral immunity:

    • Systemic antibody responses: Measure total IgG and subclass (IgG1, IgG2a) titers by ELISA; higher titers correlate with better protection

    • Neutralizing antibody titers: Quantify using virus neutralization assays with reporter viruses (e.g., recombinant CDV expressing GFP)

    • Antibody avidity: Assess the strength of antibody binding using chaotropic agents; high-avidity antibodies provide superior protection

    • Mucosal antibodies: Measure IgA in nasal secretions and other mucosal surfaces, which are critical for protection at viral entry points

  • Cellular immunity:

    • T cell responses: Quantify antigen-specific T cells using ELISPOT for IFN-γ (Th1) and IL-4 (Th2) production

    • Cellular proliferation: Measure lymphocyte proliferation in response to antigen re-stimulation

    • Cytokine profiles: Evaluate Th1/Th2 balance through cytokine quantification (IFN-γ, IL-2, IL-4, IL-10)

  • Innate immunity and dendritic cell activation:

    • Co-stimulatory molecules: Analyze upregulation of CD80 and CD86 on dendritic cells

    • Antigen presentation: Assess MHC class II expression and antigen processing

  • Challenge studies:

    • Viral load reduction: Quantify viral RNA in blood and tissues following challenge

    • Clinical protection: Monitor for absence of clinical signs

    • Immunopathology: Examine for absence of enhanced disease or immunopathology

  • Duration of immunity:

    • Long-term antibody persistence: Follow antibody titers over time (6-12 months post-vaccination)

    • Memory responses: Assess recall responses through ex vivo stimulation of lymphocytes

Research has demonstrated that recombinant CDV H nanoparticles induce robust humoral and cellular immunity, with significantly higher IFN-γ and IL-4-secreting cell populations in the spleen and lymph nodes compared to soluble H protein formulations .

How can genetic analysis of the H gene help monitor CDV evolution and vaccine efficacy?

Genetic analysis of the CDV H gene provides crucial insights into viral evolution and potential vaccine escape through several methodological approaches:

  • RT-PCR amplification and sequencing:

    • Design primers targeting conserved regions flanking the H gene

    • Amplify the complete H gene (approximately 1.8 kb) from clinical specimens

    • Perform direct sequencing or clone PCR products for sequencing

    • Compare sequences between multiple isolates and reference strains

  • Restriction Fragment Length Polymorphism (RFLP) analysis:

    • Utilize restriction enzymes (e.g., FbaI, NdeI) that differentially digest H genes based on genotype

    • Compare digestion patterns between field isolates and vaccine strains

    • Use as a rapid screening tool for preliminary genotyping

  • Phylogenetic analysis:

    • Align H gene sequences with reference sequences from different lineages

    • Construct phylogenetic trees using appropriate evolutionary models

    • Identify emergence of new lineages (e.g., Asia-4) and their relationships to vaccine strains

    • Calculate evolutionary distances between field isolates and vaccine strains

  • Recombination detection:

    • Apply recombination detection algorithms to identify potential recombination events

    • Analyze parental lineages contributing to recombinant viruses (e.g., Asia-1 and America-2)

    • Assess implications for vaccine coverage and viral evolution

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or negative selection

    • Identify specific epitopes under immune selection pressure

    • Monitor changes in receptor binding sites that might affect host range

Research has revealed substantial genetic diversity among field isolates, with the highest antigenic variation found in the H protein. Studies have identified at least two CDV genotypes circulating in Japan alone, with significant genetic differences between current field isolates and vaccine strains developed decades ago . This genetic divergence may contribute to occasional vaccine failures and highlights the need for ongoing surveillance and potential vaccine updates.

What techniques are available for analyzing CDV H protein interactions with host receptors?

Analyzing CDV H protein interactions with host receptors requires sophisticated techniques spanning structural, biochemical, and cellular approaches:

  • Protein-protein interaction assays:

    • Surface Plasmon Resonance (SPR): Determine binding kinetics (ka, kd) and affinity (KD) between purified recombinant H protein and soluble receptors

    • Biolayer Interferometry: Measure real-time binding of H protein variants to immobilized receptors

    • Co-immunoprecipitation: Assess physical interactions between H protein and receptor molecules in cellular contexts

  • Structural analysis:

    • X-ray crystallography: Determine atomic-level structures of H protein in complex with receptor molecules

    • Cryo-electron microscopy: Visualize H protein tetramers and their conformational changes upon receptor binding

    • Homology modeling: Predict interactions when crystal structures are unavailable, especially for adapted variants

  • Cell-based fusion assays:

    • Quantitative fusion assays: Measure cell-cell fusion efficiency using reporter systems (e.g., luciferase) in cells expressing different species' receptor variants

    • Syncytia formation assays: Visualize and quantify multinucleated giant cells formed by H-F mediated fusion in various cell types

  • Receptor usage studies:

    • Flow cytometry: Measure binding of fluorescently labeled H proteins to cells expressing different receptors

    • Receptor competition assays: Use soluble receptors or receptor-blocking antibodies to determine binding specificity

    • Virus infection assays: Compare infection efficiency in cells expressing receptors from different species

  • Mutagenesis approaches:

    • Alanine scanning mutagenesis: Systematically substitute key residues to identify critical interaction sites

    • Site-directed mutagenesis: Create specific mutations (e.g., D540G) identified in adapted strains to confirm their role in altered receptor usage

    • Domain swapping: Exchange regions between H proteins of different strains or viruses to map interaction domains

Research has demonstrated that specific mutations in the receptor-binding domain of CDV H protein can alter receptor specificity, enabling adaptation to new host species. For example, the D540G mutation within the RBD enhances binding to human SLAM, facilitating infection of human immune cells .

How does the H protein contribute to CDV neurovirulence and cell tropism?

The H protein plays a pivotal role in determining CDV neurovirulence and cell tropism through several key mechanisms:

  • Receptor recognition diversity:

    • The H protein mediates binding to SLAM (CD150) on immune cells, facilitating initial infection

    • Adaptation of the H protein enables recognition of additional receptors, including Nectin-4 on epithelial cells and unknown receptors on neuronal cells

    • These receptor interactions collectively determine tissue tropism and disease progression

  • Fusion efficiency modulation:

    • H protein variants exhibit differential fusion promotion activity in concert with the F protein

    • Studies comparing wild-type isolates (e.g., CDV 5804) with vaccine strains (e.g., Onderstepoort) demonstrate that the H protein is the main determinant of fusion efficiency

    • Enhanced fusion activity correlates with increased neurovirulence, as demonstrated in recombinant virus studies

  • Growth kinetics influence:

    • H protein determines viral growth characteristics in neuronal cells

    • Recombinant viruses expressing H proteins from different strains show corresponding growth patterns regardless of viral backbone

    • These growth characteristics affect viral persistence and spread within the central nervous system

  • Strain-specific neuroinvasiveness:

    • Wild-type CDV strains with specific H proteins frequently spread to the central nervous system, causing neuropathological alterations

    • Vaccine strains with attenuated H proteins demonstrate reduced neuroinvasiveness

    • Recombinant viruses carrying wild-type H proteins in vaccine strain backgrounds regain neuroinvasive properties

  • N-glycosylation effects:

    • N-glycosylation patterns of the H protein influence neurovirulence

    • Recombinant viruses expressing N-glycan-deficient H proteins show reduced pathogenesis while maintaining immunosuppressive properties

    • This suggests that N-glycosylation of H protein contributes specifically to neuropathogenesis mechanisms

These findings have been validated through reverse genetics approaches where H genes from different strains were swapped, resulting in recombinant viruses that adopted the tropism and neurovirulence characteristics of the H protein donor strain regardless of the genetic backbone .

What methodologies can determine the minimal functional requirements for CDV H protein?

Determining the minimal functional requirements for CDV H protein involves systematic molecular dissection approaches:

  • Post-translational modification analysis:

    • N-glycosylation site mapping: Use site-directed mutagenesis to systematically eliminate potential N-glycosylation sites (N-X-S/T motifs) in the H protein sequence

    • Biochemical characterization: Assess which sites are actually utilized through enzymatic deglycosylation assays and mobility shift analysis

    • Sequential elimination: Generate a series of mutants with progressively fewer N-glycosylation sites to identify the minimal complement needed for function

  • Domain deletion studies:

    • Truncation mutants: Create a series of N- and C-terminal truncations to identify essential regions

    • Internal deletion analysis: Generate internal deletions targeting specific functional domains

    • Expression assessment: Evaluate protein expression levels, stability, and subcellular localization of deletion mutants

  • Functional assessment approaches:

    • Cell surface expression: Quantify trafficking to the plasma membrane using cell surface biotinylation or flow cytometry

    • Receptor binding assays: Measure binding to SLAM/CD150 and other receptors

    • Fusion promotion: Analyze ability to trigger F protein-mediated membrane fusion using quantitative cell-cell fusion assays

  • Recombinant virus generation:

    • Viral recovery: Generate recombinant viruses expressing progressively modified H proteins using reverse genetics systems

    • Growth kinetics: Assess virus replication in various cell types

    • In vivo pathogenesis: Evaluate virulence in animal models (e.g., ferrets)

  • Structure-function correlation:

    • Critical residue identification: Use alanine scanning mutagenesis to identify key amino acids for each function

    • Conserved motif analysis: Compare sequences across morbilliviruses to identify evolutionarily conserved elements

    • Structural modeling: Generate molecular models to predict the impact of modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.