Recombinant Canis latrans Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

General Information

Canis latrans refers to the coyote species. Recombinant Canis latrans Cytochrome c oxidase subunit 2 (MT-CO2) is the protein produced through recombinant DNA technology, utilizing the genetic sequence of the coyote (Canis latrans) to express the protein in a controlled in-vitro system .

Table 1: General Information of Recombinant Canis latrans Cytochrome c Oxidase Subunit 2 (MT-CO2)

PropertyDescription
SpeciesCanis latrans (Coyote)
SynonymsCOII, COXII, MTCO2
Uniprot NO.P67781
Sourcein vitro E. coli expression system
Expression Region1-227

Structure and Function

COX2 acts as a proton pump that is involved in the transfer of cytochrome c to oxygen molecules and the reduction of oxygen molecules from water molecules . The protein sequence for Canis latrans Cytochrome c oxidase subunit 2 (MT-CO2) is :
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS
YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV

Applications

Recombinant Canis latrans Cytochrome c oxidase subunit 2 (MT-CO2) can be utilized in several research areas:

  • Protein Studies: Serving as a standard for protein structure and function studies.

  • Antibody Production: Used to generate antibodies for detecting COX2 in coyotes.

  • Drug Discovery: Facilitating the discovery of molecules targeting COX2.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Canis latrans (Coyote)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprised of succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, containing heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Canis latrans MT-CO2?

The E. coli expression system is currently the most widely used platform for producing recombinant MT-CO2 from Canis species. This approach allows for high-yield production of the target protein with an N-terminal His tag for purification purposes. The bacterial expression system offers several advantages over other expression platforms, including cost-effectiveness, scalability, and relatively straightforward optimization protocols .

When expressing MT-CO2, researchers should consider the following optimization parameters:

ParameterRecommended ConditionsConsiderations
E. coli strainBL21(DE3)Protease-deficient for better protein stability
Induction temperature16-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMLower concentrations favor soluble protein expression
Expression duration16-20 hoursExtended expression at lower temperatures improves yield
Media compositionTB or LB with supplementsAddition of trace elements may improve expression

What purification strategies yield the highest purity of recombinant MT-CO2?

For His-tagged recombinant MT-CO2, a multi-step purification approach is recommended to achieve >90% purity as typically required for functional studies. The standard protocol involves:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins as the primary capture step

  • Size exclusion chromatography to remove aggregates and improve homogeneity

  • Ion exchange chromatography as a polishing step if necessary

Typical purification yields approximately 1-5 mg of purified protein per liter of bacterial culture with purity exceeding 90% as determined by SDS-PAGE . The protein should be maintained in a storage buffer containing Tris/PBS, pH 8.0, with 6% trehalose to enhance stability during freeze-thaw cycles .

What are the key structural features of Canis latrans MT-CO2 compared to other Canis species?

Canis latrans MT-CO2 exhibits high sequence homology with other Canis species, particularly with Canis lupus (wolf) and Canis familiaris (domestic dog). Based on comparative sequence analysis across Canidae, the following features are notable:

  • The mature protein typically consists of 220-227 amino acids with several conserved domains

  • MT-CO2 contains highly conserved heme-binding motifs important for electron transport function

  • The protein features membrane-spanning regions that anchor it within the mitochondrial inner membrane

  • Species-specific variations occur primarily in non-conserved loop regions, which can be used for species identification and phylogenetic analysis

The amino acid sequence shows approximately 95-98% identity with other Canis species, with variations that can be used for species discrimination in DNA barcoding applications .

How does the function of recombinant MT-CO2 differ from native mitochondrial MT-CO2?

Recombinant MT-CO2 produced in bacterial systems lacks the mitochondrial environment necessary for complete assembly and full functional activity. Key differences include:

  • Post-translational modifications: Native MT-CO2 undergoes specific modifications within the mitochondria that are absent in recombinant versions

  • Complex assembly: In vivo, MT-CO2 functions as part of cytochrome c oxidase complex (Complex IV), whereas recombinant protein exists primarily as a monomeric or dimeric form

  • Cofactor binding: Native MT-CO2 requires association with metal ions and heme groups for electron transport activity

For functional studies, reconstitution approaches incorporating heme and copper cofactors may improve the similarity to native protein. When designing such studies, researchers should consider supplementation with copper chaperones such as Cox17 or Cox19 which facilitate metal incorporation into the cytochrome c oxidase complex .

How reliable is MT-CO2 for species identification within the Canis genus compared to other genetic markers?

MT-CO2 provides reliable species discrimination within the Canis genus, though it shows slightly lower resolution than cytochrome c oxidase subunit 1 (COI). Analysis of MT-CO2 sequences enables:

  • Clear differentiation between Canis latrans and Canis lupus with approximately 98% accuracy

  • Identification of hybrid specimens when used in conjunction with nuclear markers

  • Reliable assignment of unknown samples to the species level within the Canidae family

A comparative analysis of mitochondrial markers for Canis species identification shows:

Genetic MarkerResolution PowerApplication StrengthLimitations
MT-CO1Very HighPrimary barcoding standardSome intraspecific variation
MT-CO2HighComplementary to CO1, good for degraded samplesSlightly lower resolution than CO1
Cytochrome bModerate-HighWell-established databaseLess discriminatory for closely related species
D-loopVery HighHighest variationProne to homoplasy

When working with ancient or degraded DNA samples, MT-CO2 often provides more reliable results than longer markers due to its relatively compact size and the abundance of mitochondrial DNA in samples .

What phylogenetic insights can be gained from comparative analysis of MT-CO2 across different canid species?

MT-CO2 sequence analysis has proven valuable for understanding evolutionary relationships within Canidae. Key insights include:

  • Divergence timing between wolf and coyote lineages (approximately 1-2 million years ago)

  • Evidence of historical hybridization events between Canis species

  • Population structure and geographical diversification within Canis latrans

  • Maternal lineage tracing in domesticated and wild canid populations

When conducting phylogenetic analyses, researchers should employ multiple models (Maximum Likelihood, Bayesian Inference) and include outgroups from other canid genera to ensure robust tree topology. The nucleotide substitution rate for MT-CO2 in canids is estimated at approximately 1.5-2% per million years, making it suitable for relatively recent divergence studies .

What PCR conditions are optimal for amplifying the complete MT-CO2 gene from Canis latrans samples?

For reliable amplification of the complete MT-CO2 gene (approximately 1100 bp) from Canis latrans samples, the following optimized PCR protocol is recommended:

Primer design:
Forward primer: 5'-GAGAAGTGGCAGTGATTGAGC-3' (Tm ≈ 58°C)
Reverse primer: 5'-TGGGGTAGTAAAAGAGGCGAA-3' (Tm ≈ 58°C)

PCR reaction components:

  • 12.5 μL 2X TaqMasterMix

  • 1 μL each primer (10 μM)

  • 2 μL template DNA (10 ng/μL for high-quality samples, up to 100 ng/μL for degraded samples)

  • Nuclease-free water to 25 μL total volume

Thermal cycling conditions:

  • Initial denaturation: 95°C for 5 minutes

  • 28-35 cycles of:

    • Denaturation: 95°C for 30 seconds

    • Annealing: 58.5°C for 30 seconds

    • Extension: 72°C for 90 seconds

  • Final extension: 72°C for 10 minutes

For difficult samples, the addition of 5-10% DMSO or 1M betaine may improve amplification efficiency by reducing secondary structure formation in GC-rich regions.

How can researchers optimize heterologous expression of functional MT-CO2 with proper cofactor incorporation?

Achieving functional expression of MT-CO2 requires attention to cofactor incorporation, particularly heme and copper. The following approach has proven effective:

  • Co-expression with System I (CcmABCDEFGH) bacterial cytochrome c biogenesis pathway components to facilitate heme attachment

  • Supplementation of growth media with δ-aminolevulinic acid (ALA, 1 mM) to enhance heme biosynthesis

  • Addition of copper sulfate (50-100 μM) to growth media during expression

  • Co-expression with copper chaperones (Cox17 or Cox19) to facilitate copper incorporation

  • Expression at lower temperatures (16-20°C) to allow proper folding and cofactor incorporation

Following purification, functional assessment can be performed using spectrophotometric analysis (reduced vs. oxidized spectra) and oxygen consumption assays. Properly folded MT-CO2 with heme incorporation will show characteristic absorption peaks at approximately 550-560 nm in the reduced state .

How can recombinant MT-CO2 be used to investigate evolutionary adaptations in coyote metabolism?

Recombinant MT-CO2 provides a valuable tool for investigating metabolic adaptations in Canis latrans through several approaches:

  • Enzyme kinetics analysis: Comparing catalytic efficiency of MT-CO2 from coyotes with that from other canids can reveal adaptations to different energetic demands. This can be accomplished through oxygen consumption assays under varying substrate concentrations and temperature conditions.

  • Thermal stability studies: Differential scanning calorimetry and circular dichroism spectroscopy can assess the thermal stability of recombinant MT-CO2, potentially revealing adaptations to the diverse climatic conditions coyotes inhabit across North America.

  • Site-directed mutagenesis: Introducing species-specific amino acid changes can help identify the functional significance of evolutionary substitutions between canid species.

  • Protein-protein interaction studies: Using pull-down assays or surface plasmon resonance to compare interaction affinities with other respiratory complex components across species .

This comparative approach has revealed that certain amino acid substitutions in MT-CO2 correlate with metabolic adaptations to environmental factors, including altitude, temperature ranges, and prey availability across different canid populations .

What approaches can be used to study the role of MT-CO2 variants in canid disease models?

Investigating MT-CO2 variants in canid disease models requires multi-faceted approaches:

  • Generation of site-specific variants: Using site-directed mutagenesis to recreate naturally occurring or disease-associated MT-CO2 variants in the recombinant protein

  • Functional characterization: Assessing electron transfer efficiency, oxygen consumption rates, and ROS (reactive oxygen species) production of variant proteins compared to wild-type

  • Structural analysis: Using CD spectroscopy, thermal stability assays, and potentially X-ray crystallography or cryo-EM to determine how variants affect protein structure

  • Cell-based assays: Transfection of MT-CO2 variants into cellular models (ideally canid-derived cell lines) with endogenous MT-CO2 knockdown to assess mitochondrial function, including membrane potential, ATP production, and apoptotic sensitivity

These approaches can provide valuable insights into mitochondrial diseases that affect both wild and domestic canids, potentially informing veterinary medicine and conservation efforts .

What strategies can address poor yield and solubility issues when expressing recombinant MT-CO2?

Poor yield and solubility are common challenges when expressing membrane-associated proteins like MT-CO2. The following strategies can help overcome these issues:

  • Fusion tag optimization: While His-tags are standard, alternative fusion partners can dramatically improve solubility:

    • MBP (maltose-binding protein) fusion can increase solubility

    • SUMO fusion often improves both expression and solubility

    • Thioredoxin fusion can enhance disulfide bond formation

  • Expression conditions optimization:

    • Lower the incubation temperature to 16°C

    • Reduce IPTG concentration to 0.1-0.2 mM

    • Use richer media formulations like Terrific Broth supplemented with trace elements

  • Solubilization approaches:

    • Add mild detergents (0.5-1% n-dodecyl-β-D-maltoside) to extraction buffers

    • Include 5-10% glycerol in all buffers to enhance stability

    • Test different pH conditions (pH 7.0-8.5) for optimal solubility

For particularly difficult expressions, cell-free protein synthesis systems have shown promise, allowing better control of the reaction environment and direct incorporation of solubilizing agents .

How can researchers address inconsistent functional activity in recombinant MT-CO2 preparations?

Inconsistent functional activity is often related to incomplete cofactor incorporation or improper folding. These approaches can help standardize functional activity:

  • Improved cofactor incorporation:

    • Supplement expression media with heme precursors (δ-aminolevulinic acid)

    • Add copper ions (50-100 μM CuSO₄) during expression

    • Co-express with copper chaperones like Cox17 that facilitate copper delivery

  • Refolding protocols:

    • Controlled denaturation followed by step-wise dialysis to remove denaturants

    • Addition of oxidized/reduced glutathione pairs (1:10 ratio) to facilitate correct disulfide formation

    • Inclusion of lipids or detergent micelles to mimic membrane environment

  • Activity standardization:

    • Develop a specific activity assay (μmol substrate/min/mg protein)

    • Use cytochrome c reduction assays as a functional readout

    • Establish internal reference standards for batch-to-batch comparison

Additionally, characterization by circular dichroism spectroscopy can help verify proper secondary structure formation, which correlates strongly with functional activity .

How is MT-CO2 being utilized in climate change adaptation research in wild canid populations?

MT-CO2 has emerged as an important marker in studying climate change adaptation in canids due to its role in cellular energy production. Current research focuses on:

  • Population genomics approaches: Sequencing MT-CO2 across geographically diverse coyote populations to identify adaptive variants associated with different thermal environments

  • Functional metabolic studies: Comparing oxygen consumption efficiency and thermal stability of MT-CO2 variants from populations in different climate zones

  • Selection pressure analysis: Using dN/dS ratios to detect signatures of positive selection on specific MT-CO2 codons in populations from extreme environments

  • Ancient DNA comparisons: Analyzing MT-CO2 sequences from historical/ancient specimens to track adaptive changes over time as climate has changed

Recent studies have revealed evidence of purifying selection on MT-CO2 in canid species, with a significant dN/dS ratio < 1 (approximately 0.038), indicating strong functional constraints even as species adapt to changing environments .

What role does MT-CO2 play in comparative studies of metabolic efficiency across canid species with different hunting strategies?

MT-CO2, as a critical component of the electron transport chain, is increasingly used to investigate metabolic adaptations related to different hunting strategies across canids:

  • Comparative enzymatic efficiency: Studies comparing MT-CO2 efficiency between pursuit predators (wolves) versus ambush predators (coyotes) have revealed specific amino acid substitutions that correlate with different hunting energetics

  • Tissue-specific expression analysis: Investigation of MT-CO2 expression levels in different muscle types (slow-twitch vs. fast-twitch) across canid species with different hunting behaviors

  • Respiratory complex assembly studies: Analysis of how MT-CO2 variants influence the assembly efficiency of respiratory Complex IV in species with different energetic demands

  • Metabolic scaling research: Investigation of how body size differences between canid species correlate with MT-CO2 sequence variations and functional properties

These studies contribute to our understanding of how evolutionary pressures related to predation strategies have shaped energetic metabolism at the molecular level across the Canidae family .

What ethical considerations should researchers address when collecting Canis latrans samples for MT-CO2 studies?

Research involving Canis latrans samples demands careful ethical consideration:

  • Sampling permits and regulations:

    • Obtain appropriate wildlife collection permits from relevant authorities

    • Adhere to CITES regulations if samples cross international borders

    • Follow institutional animal care protocols for any live sampling

  • Sample collection methods:

    • Prioritize non-invasive sampling methods (fecal samples, shed hair) when possible

    • Use minimal tissue amounts from specimens collected for other purposes

    • Ensure humane handling and anesthesia protocols for any live sampling

  • Respect for Indigenous knowledge and territories:

    • Engage with Indigenous communities when sampling occurs on traditional territories

    • Acknowledge traditional knowledge about coyote populations in research publications

    • Consider benefit-sharing agreements when research may have commercial applications

  • Data sharing and biorepository ethics:

    • Deposit sequence data in public databases with appropriate metadata

    • Consider the implications of sharing genetic data that may impact vulnerable populations

    • Develop clear material transfer agreements for any sample sharing

How can MT-CO2 research contribute to conservation management of canid populations?

MT-CO2 sequence analysis provides valuable tools for conservation management:

  • Hybridization monitoring: MT-CO2 can help identify hybridization between coyotes and wolves or domestic dogs, a key conservation concern in many regions

  • Population genetic health assessment: Analysis of MT-CO2 diversity within populations can serve as one indicator of genetic health and historic bottlenecks

  • Forensic applications:

    • Species identification in wildlife trafficking cases

    • Source population assignment for poaching investigations

    • Authentication of canid products in illegal wildlife trade

  • Climate change vulnerability assessment: Studying functional variations in MT-CO2 across populations can help predict which populations might be more vulnerable to thermal stress under climate change scenarios

Integrating MT-CO2 data with other genetic markers and ecological information strengthens evidence-based conservation management for wild canid populations facing multiple anthropogenic threats .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.