Recombinant Canis lupus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics

Recombinant Canis lupus MT-ATP6 is produced in yeast (Saccharomyces cerevisiae), leveraging biotechnological methods to express the partial protein sequence. Key parameters include:

PropertyDetail
Product CodeCSB-YP624913CCW1
SourceYeast
Immunogen SpeciesCanis lupus (Gray wolf)
Purity>85% (verified via SDS-PAGE)
Storage-20°C/-80°C (lyophilized form stable for 12 months; liquid form for 6 months)
ReconstitutionDeionized sterile water with 5–50% glycerol recommended for stability
TagDetermined during manufacturing
Uniprot IDQ1HKB1
Protein LengthPartial sequence

This recombinant protein lacks the full-length structure but retains functional regions critical for studying ATP synthase mechanics .

Research Applications

Recombinant MT-ATP6 enables studies on:

  • Mitochondrial Diseases: Mutations in MT-ATP6 are linked to Leigh syndrome (10–20% of cases) and neuropathy . Recombinant variants help dissect pathogenic mechanisms, such as impaired proton transport .

  • Enzyme Dynamics: Yeast models expressing homologs (e.g., S. cerevisiae) reveal how substitutions disrupt ATP synthase function .

  • Drug Interactions: Oligomycin, an F<sub>O</sub> inhibitor, binds MT-ATP6, making this protein useful for testing ATP synthase inhibitors .

Comparative Insights

While human and Canis lupus MT-ATP6 share functional homology, structural differences exist:

  • Sequence Overlap: Human MT-ATP6 overlaps with MT-ATP8 by 46 nucleotides, complicating mutation analysis .

  • Yeast Compatibility: Yeast models successfully mimic human MT-ATP6 dysfunction, validating cross-species studies .

Challenges and Future Directions

  • Partial Protein Limitations: The recombinant product’s partial sequence may omit regions critical for full enzymatic activity .

  • Heteroplasmy Effects: Mitochondrial DNA variants exist in mixed populations within cells, complicating in vitro studies .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type preferences, please inform us and we will prioritize developing the requested tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Canis lupus (Gray wolf)
Target Names
Target Protein Sequence
MNENLFASFAAPSMMGLPIVVLIVMFPSILFPTPSRLINNRLISIQQWLIQLTSKQMLAI HNQKGRTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRYK TKASLAHFLPQGTPLPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LINISATTAFITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for synthesizing ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by the electron transport complexes of the respiratory chain. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. As a key component of the proton channel, subunit a potentially plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in cellular bioenergetics?

MT-ATP6 encodes the ATP synthase subunit a, a critical component of mitochondrial ATP synthase (Complex V) in the oxidative phosphorylation system. This protein functions within the membrane domain of F-ATPase, where it works in conjunction with the c-ring to facilitate proton translocation across the inner mitochondrial membrane. The proton-motive force generated by respiration is mechanically coupled to ATP synthesis through rotation of the central stalk and attached c-ring at approximately 100 rotations per second. Each 360° rotation produces three ATP molecules and requires the translocation of one proton per glutamate by each c-subunit in the ring . The a-subunit (MT-ATP6) provides part of the transmembrane path for protons and sits close to the surface of the c-ring in the membrane domain . This proton pathway is essential for converting the energy from the proton gradient into the mechanical rotation that drives ATP synthesis.

How conserved is MT-ATP6 across species, and what does this tell us about its evolutionary importance?

MT-ATP6 shows remarkable conservation across vertebrate species, with nearly identical sequences throughout almost all vertebrates and high conservation among invertebrates . This high degree of conservation suggests critical functional constraints on this protein. The conservation is particularly notable in the transmembrane regions and proton-conducting pathways. Based on structural studies, the bovine F-ATPase contains an eight-subunit c-ring, and this c8-ring structure is likely conserved across approximately 50,000 vertebrate species and potentially many of the estimated two million invertebrate species . This conservation indicates that the 2.7 protons required to synthesize each ATP molecule represents an optimized bioenergetic cost that has been maintained throughout extensive evolutionary diversification of vertebrates and many invertebrates.

What are the optimal expression systems for producing recombinant MT-ATP6 protein?

For recombinant expression of MT-ATP6, Escherichia coli has been successfully employed as evidenced in the production of Canis lupus ATP synthase subunit a . The specific E. coli strain selection depends on research requirements, with BL21(DE3) and its derivatives being common choices for membrane protein expression. For MT-ATP6, which is a hydrophobic membrane protein with multiple transmembrane domains, specialized E. coli strains like C41(DE3) or C43(DE3) that are optimized for membrane protein expression may yield better results.

The expression construct typically includes an N-terminal His-tag to facilitate purification, as demonstrated in the recombinant production of full-length Canis lupus MT-ATP6 (1-226 amino acids) . Alternative expression systems, including yeast (particularly Pichia pastoris) and insect cell systems, may be considered for cases where E. coli expression results in protein misfolding or inclusion body formation.

What purification strategies are most effective for isolating functional MT-ATP6?

Purification of recombinant MT-ATP6 typically follows a multi-step protocol:

  • Initial purification using immobilized metal affinity chromatography (IMAC) exploiting the His-tag

  • Detergent selection is critical - studies with bovine F1-c-ring complex used detergents to dissociate the peripheral stalk and other membrane components while preserving the integrity of the c-ring structure

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Ion exchange chromatography for further purification if needed

For functional studies, it's essential to maintain the protein in appropriate detergent micelles or reconstitute it into lipid nanodiscs or liposomes. The bovine F1-c-ring complex was successfully prepared from purified ATP synthase by selective dissociation of the peripheral stalk, subunit a, and other minor membrane subunits (A6L, e, f, and g) with detergents while preserving the catalytic F1-domain and the c-subunit .

What techniques are most informative for determining the structure of MT-ATP6 and its interactions within ATP synthase?

The structural analysis of MT-ATP6 requires a combination of complementary techniques:

  • X-ray Crystallography: Has been successfully used to determine high-resolution structures of various components of ATP synthase, including the F1-c-ring complex from bovine mitochondria at resolutions as high as 1.9Å .

  • Electron Cryomicroscopy (Cryo-EM): Particularly valuable for visualizing the intact ATP synthase complex, as demonstrated in studies achieving 32Å resolution of the bovine enzyme . Recent advances in cryo-EM technology now allow for significantly higher resolution structures.

  • Mosaic Structure Building: Combining high-resolution component structures by docking them into lower-resolution electron microscopy maps provides comprehensive structural models. This approach was used to create a mosaic structure of bovine ATP synthase by integrating the F1-c-ring structure with other component structures .

  • Cross-linking Mass Spectrometry: Helps identify protein-protein interactions within the complex, elucidating how MT-ATP6 interfaces with other subunits.

The current structural understanding of MT-ATP6 remains incomplete, as indicated by the "empty gray region" in structural models representing the membrane domain where detailed structural information for subunit a is lacking . This highlights the ongoing challenge of determining membrane protein structures, particularly within large complexes like ATP synthase.

How does the structure of Canis lupus MT-ATP6 compare with other species, and what functional implications do these differences have?

Structural comparisons between Canis lupus MT-ATP6 and other species reveal important evolutionary adaptations in ATP synthase function. While the search results don't provide direct comparative data for Canis lupus specifically, structural studies of ATP synthase across species demonstrate variations in the c-ring size, which directly impacts bioenergetic efficiency.

Speciesc-ring sizeProtons required per ATPReference
Bovine (and likely other vertebrates)c8-ring2.7
Fungi, eubacteria, plant chloroplastsc10-c15 rings3.3-5

The smaller c-ring in vertebrates (including what's likely in Canis lupus) indicates a more energy-efficient ATP production system, requiring fewer protons per ATP molecule synthesized. This structural distinction suggests evolutionary optimization of bioenergetic efficiency in higher organisms. The conservation of smaller c-rings across vertebrates implies that Canis lupus MT-ATP6 would share similar efficiency characteristics with other mammalian species, requiring approximately 2.7 protons per ATP molecule .

What pathological mutations have been identified in MT-ATP6, and what molecular mechanisms underlie their clinical manifestations?

Mutations in MT-ATP6 have been associated with several mitochondrial disorders:

  • Striatal Necrosis Syndromes: Approximately 10-20% of individuals with Leigh syndrome (LS) and more than 50% of individuals with neurogenic muscle weakness, ataxia and retinitis pigmentosa (NARP) have mutations at nucleotide position 8993 of the MT-ATP6 gene .

  • Expanding Clinical Phenotypes: Beyond the classic MT-ATP6-associated disorders, research has identified mutations at various positions with diverse clinical presentations:

    • m.9025G>A: Found in patients with 3-methylglutaconic aciduria and MILS

    • m.9029A>G: Associated with hereditary optic neuropathy

    • m.9032T>C: Linked to NARP/MILS phenotypes

    • m.8618-8619insT, m.8839G>C, m.8989G>C: New pathologic mutations for NARP/MILS syndromes

    • m.9185T>C: Identified in Charcot-Marie-Tooth disease and episodic weakness

    • m.8528T>C: Found in infantile cardiomyopathy

The molecular mechanisms underlying these pathologies often involve:

  • Impaired proton translocation across the inner mitochondrial membrane

  • Reduced ATP synthesis capacity

  • Bioenergetic deficiency leading to tissue-specific manifestations, particularly in high-energy-demand tissues like the nervous system

  • Potential impact on mitochondrial membrane potential and reactive oxygen species production

How can researchers effectively screen for MT-ATP6 mutations in patients with suspected mitochondrial disorders?

Effectively screening for MT-ATP6 mutations requires a comprehensive approach:

  • Targeted Gene Sequencing: Direct sequencing of the MT-ATP6 gene should be performed in patients with clinical phenotypes suggestive of mitochondrial disorders, even in the absence of histochemical or biochemical evidence of respiratory chain dysfunction .

  • Whole Mitochondrial Genome Sequencing: To rule out other potentially pathological mutations, sequencing the complete mitochondrial genome is recommended, as performed in patients with suspected MT-ATP6 mutations .

  • Haplogroup Analysis: Determining the mitochondrial DNA haplogroup can help distinguish pathogenic mutations from population-specific polymorphisms .

  • Population Screening: Comparing identified variants against large databases of human MT-ATP6 sequences (over 25,000 sequences from various sources) helps determine the rarity and potential pathogenicity of mutations .

  • Functional Validation: For novel variants, functional studies in patient tissues and cybrid cell models are essential to confirm pathogenicity .

  • Biochemical Markers: Researchers should be aware that ATP synthase-specific activity is not regularly measured in patients' tissues because ATP synthesis can only be measured on freshly isolated, intact, and coupled mitochondria . Alternative markers such as 3-methylglutaconic acid levels may help identify MT-ATP6 defects .

Despite their connection to mitochondrial disease, MT-ATP6 mutations are often missed in routine diagnostics because patients usually do not show apparent histochemical and/or biochemical signs of oxidative phosphorylation dysfunction . Therefore, MT-ATP6 gene sequencing should be performed at least in all patients suspected of suffering from a mitochondrial DNA disorder who show normal results in histochemical and biochemical analyses of the respiratory chain .

How can recombinant MT-ATP6 be used to study ATP synthesis mechanisms and proton translocation?

Recombinant MT-ATP6, such as the His-tagged Canis lupus protein expressed in E. coli , provides valuable tools for investigating ATP synthesis mechanisms:

  • Reconstitution Studies: Purified MT-ATP6 can be reconstituted with other ATP synthase components in liposomes to create minimal functional systems for studying proton translocation and ATP synthesis mechanisms.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues in recombinant MT-ATP6 can identify amino acids critical for proton channel formation, interactions with c-subunits, and other functional aspects.

  • Proton Translocation Assays: Using pH-sensitive fluorescent probes in reconstituted systems with recombinant MT-ATP6 to directly measure proton movement across membranes.

  • Structural Studies: Purified recombinant MT-ATP6 can contribute to structural determination by X-ray crystallography or cryo-EM, particularly for regions that remain structurally undefined, such as the membrane domain containing subunit a that provides the transmembrane proton path .

  • Binding Studies: Investigating interactions between MT-ATP6 and other subunits or small molecule inhibitors using techniques like isothermal titration calorimetry or surface plasmon resonance.

These approaches can help elucidate the precise mechanisms by which proton translocation through MT-ATP6 is coupled to the rotary motion of the c-ring and ultimate ATP synthesis.

What experimental systems are best suited for studying the effects of MT-ATP6 mutations on ATP synthesis and mitochondrial function?

Several experimental systems provide valuable insights into MT-ATP6 mutation effects:

  • Cybrid Cell Models: Creating transmitochondrial cybrids by fusing patient-derived platelets or enucleated fibroblasts with rho-zero cells (cells depleted of mitochondrial DNA) allows the study of MT-ATP6 mutations in a controlled nuclear background.

  • Patient-Derived Fibroblasts: Primary cultures from patients with MT-ATP6 mutations provide natural systems for studying pathophysiology.

  • CRISPR-Engineered Cellular Models: While direct mitochondrial DNA editing remains challenging, nuclear-encoded versions of MT-ATP6 with appropriate targeting sequences can be manipulated using CRISPR technology.

  • Yeast Models: S. cerevisiae provides a tractable system for studying equivalent mutations in the yeast ATP6 gene, with the advantage of facile genetic manipulation.

  • Mouse Models: While technically challenging, mouse models with MT-ATP6 mutations can provide insights into tissue-specific effects and systemic manifestations.

For quantitative functional assessments, researchers should implement:

  • Direct measurements of ATP synthesis rates in isolated mitochondria

  • Oxygen consumption analysis using high-resolution respirometry

  • Membrane potential measurements using potentiometric dyes

  • In-gel activity assays for ATP synthase complex assembly and function

  • Blue native PAGE for analyzing complex assembly states

These systems collectively enable comprehensive characterization of how specific MT-ATP6 mutations impact ATP synthesis, mitochondrial bioenergetics, and cellular physiology.

How does the bioenergetic efficiency of ATP synthesis differ between species based on their MT-ATP6 and c-ring structures?

The bioenergetic efficiency of ATP synthesis varies significantly across species due to differences in ATP synthase structure, particularly in the c-ring size which directly impacts the number of protons required to synthesize each ATP molecule:

Phylogenetic Groupc-ring StructureProtons Required per ATPBioenergetic Cost
Vertebrates (including Canis lupus)c8-ring2.7Lower
Fungic10-ring3.3Medium
Eubacteriac11-c14 rings3.7-4.7Higher
Plant Chloroplastsc14-c15 rings4.7-5.0Highest

This data demonstrates a clear trend in evolutionary optimization of ATP synthesis efficiency, with vertebrates having evolved the most efficient ATP synthase structures requiring the fewest protons per ATP molecule synthesized . The conservation of the c8-ring structure across approximately 50,000 vertebrate species suggests strong evolutionary pressure to maintain this optimal configuration .

The lower bioenergetic cost in vertebrates (2.7 protons per ATP) compared to other organisms (3.3-5.0 protons per ATP) may reflect adaptation to the higher energy demands of complex multicellular organisms with advanced nervous systems and specialized tissues. This efficiency difference has profound implications for cellular energy economics, particularly in high-energy-demand tissues like brain, muscle, and heart, which are often affected in MT-ATP6-related diseases.

What insights can comparative studies of MT-ATP6 across species provide for understanding human mitochondrial diseases?

Comparative studies of MT-ATP6 across species offer valuable insights for understanding human mitochondrial diseases:

  • Conservation Mapping: Identifying highly conserved residues across species helps prioritize which variants in human patients are likely pathogenic. Mutations affecting evolutionarily conserved residues typically have more severe functional consequences.

  • Structure-Function Relationships: The 8-subunit c-ring structure found in bovine ATP synthase and likely conserved across vertebrates suggests that MT-ATP6 mutations affecting the interaction between subunit a and the c-ring will have similar pathogenic mechanisms across vertebrate species.

  • Natural Compensatory Mechanisms: Some species may have evolved compensatory mechanisms to mitigate the effects of variants that would be pathogenic in humans. Identifying these adaptations could inspire therapeutic approaches.

  • Disease Modeling: Understanding the functional equivalence of MT-ATP6 between humans and model organisms (like Canis lupus) helps validate the relevance of animal models for studying human mitochondrial diseases.

  • Therapeutic Development: Species-specific differences in drug sensitivity or metabolic bypass pathways may guide the development of precision therapies for MT-ATP6-related disorders.

The recent expansion of recognized clinical phenotypes associated with MT-ATP6 mutations underscores the importance of comprehensive genetic screening in patients with suspected mitochondrial disorders, guided by our understanding of how MT-ATP6 function is conserved across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.