Recombinant Canis simensis Cytochrome c oxidase subunit 1 (MT-CO1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant MT-CO1 is a 196-amino acid protein (UniProt ID: Q33375) expressed in E. coli with an N-terminal His tag for purification . Key structural features include:

PropertyDetail
Amino Acid SequenceXWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFAHWFPLFSGYTLNDTWAKIHFTIMFVGVNMTFFPQHF
Molecular Weight~35 kDa (observed via SDS-PAGE)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

The protein's stability is enhanced by glycerol (5–50%) during reconstitution, with long-term storage recommended at -80°C .

Functional Role in Mitochondrial Respiration

As subunit 1 of cytochrome c oxidase (Complex IV), MT-CO1 facilitates electron transfer from cytochrome c to oxygen, driving ATP synthesis via oxidative phosphorylation . Key functional attributes include:

  • Bimetallic Active Site: Contains heme A3 and copper B (CuB) for oxygen reduction .

  • Proton Pumping: Couples electron transport to proton gradient generation across the mitochondrial inner membrane .

  • Disease Associations: Mutations in MT-CO1 are linked to Leber’s hereditary optic neuropathy, cardiomyopathy, and neurodegenerative disorders .

Immunodetection and Assays

  • Western Blot (WB): Detected at 35 kDa in human skeletal muscle, rat liver, and mouse neuroblastoma lysates using monoclonal antibody ab14705 .

  • Immunohistochemistry (IHC): Localized to mitochondria in paraffin-embedded rat and mouse colon tissues .

  • Flow Cytometry: Used to quantify MT-CO1 expression in HeLa and Neuro-2a cells .

Comparative Biology

  • Species-Specific Studies: Recombinant MT-CO1 from Canis simensis enables comparative analyses with homologs in gray wolves (Canis lupus) and other canids .

  • DNA Barcoding: COI sequences (including MT-CO1) resolve taxonomic distinctions in animals, though efficacy varies in cnidarians and plants .

Expression Systems

Product CodeExpression HostApplication
RFL24132CF E. coliStructural studies, antibody production
CSB-CF654239CCX E. coli (in vitro)Enzyme kinetics, inhibitor screening
CSB-EP654239CCX1 Yeast/BaculovirusPost-translational modification studies

Antibody Compatibility

  • ab14705: Mouse monoclonal antibody validated for WB, IHC, and flow cytometry across human, mouse, and rat samples .

Recent Research Findings

  • Assembly Regulation: The C-terminal domain of Cox1 (MT-CO1) governs cytochrome c oxidase biogenesis and supercomplex stability, as shown in yeast models .

  • Diagnostic PCR: COI sequences enabled design of a multiplex PCR assay for Culicoides species identification, highlighting MT-CO1’s utility in vector biology .

  • Thermal Stability: Trehalose in storage buffers preserves structural integrity during freeze-thaw cycles .

Limitations and Considerations

  • Species Cross-Reactivity: Antibodies like ab14705 may require validation for non-model canids .

  • Functional Studies: Requires reconstitution into lipid membranes to assay proton-pumping activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CO1; COI; COXI; MTCO1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Canis simensis (Ethiopian wolf) (Simenia simensis)
Target Names
Target Protein Sequence
XWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFT VGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLT GIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFAHWFPLFSGYTLNDTWAKIHF TIMFVGVNMTFFPQHF
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (MT-CO1) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO1 and what is its function in Canis simensis?

MT-CO1 is the mitochondrial-encoded cytochrome c oxidase subunit 1, a critical component of the mitochondrial electron transport chain. In Canis simensis (Ethiopian wolf), as in other mammals, MT-CO1 functions as an integral part of Complex IV (cytochrome c oxidase) located on the inner mitochondrial membrane. This protein plays an essential role in cellular respiration by transferring electrons to molecular oxygen, resulting in water production and contributing to the proton gradient necessary for ATP synthesis . The gene encoding MT-CO1 is located in the mitochondrial genome and is highly conserved across species, making it valuable for evolutionary and phylogenetic studies.

What techniques are used to isolate and amplify the MT-CO1 gene from Canis simensis samples?

The MT-CO1 gene from Canis simensis can be isolated using standard DNA extraction protocols from tissue samples, followed by PCR amplification. Researchers typically employ universal primers that target conserved regions flanking the MT-CO1 gene. Based on established protocols for amplifying cytochrome c oxidase genes from diverse organisms, the following approach is recommended:

  • Extract total DNA from tissue samples using commercial kits or phenol-chloroform extraction.

  • Utilize universal primers such as those described by Folmer et al. for PCR amplification, which can generate approximately 710-bp fragments of the mitochondrial COI gene .

  • Optimize PCR conditions: initial denaturation at 94°C for 1 minute, followed by 35-40 cycles of denaturation (94°C, 30 seconds), annealing (48-52°C, 30 seconds), and extension (72°C, 1 minute), with a final extension at 72°C for 7 minutes.

  • Confirm amplification using 2% agarose gel electrophoresis, where bands should appear between 700-750 bp markers .

How does MT-CO1 sequence analysis contribute to phylogenetic studies of canids?

MT-CO1 sequence analysis is particularly valuable for phylogenetic studies of canids due to its unique characteristics. The MT-CO1 gene experiences relatively slow evolutionary rates in its core functional regions while accumulating silent mutations, making it ideal for species-level discrimination and population genetics studies . For Canis simensis research:

  • The conserved nature of MT-CO1 allows reliable alignment across diverse canid species, enabling robust phylogenetic tree construction.

  • Sequence variations can resolve evolutionary relationships between the Ethiopian wolf and other canids, providing insights into their divergence times and evolutionary history.

  • MT-CO1 sequences can detect population subdivisions within Canis simensis, which is crucial for conservation genetics of this endangered species.

  • When combining MT-CO1 with other mitochondrial or nuclear markers, researchers can generate multi-locus phylogenies with greater resolution and statistical support.

What expression systems are most suitable for producing recombinant Canis simensis MT-CO1?

For producing recombinant Canis simensis MT-CO1, researchers should consider the following expression systems, each with specific advantages for mitochondrial protein production:

  • Bacterial expression systems: While economical and straightforward, they often struggle with proper folding of mitochondrial membrane proteins. If using E. coli, consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Yeast expression systems (S. cerevisiae or P. pastoris): These provide eukaryotic post-translational modifications and better membrane protein folding capability, making them suitable for functional studies of MT-CO1.

  • Mammalian cell lines: HEK293 or CHO cells offer the most native-like environment for canid protein expression, particularly important when studying protein-protein interactions or conducting functional assays.

  • Cell-free expression systems: These can be advantageous for difficult-to-express proteins like MT-CO1, allowing direct incorporation into nanodiscs or liposomes.

When using any of these systems, codon optimization for the expression host is critical to enhance protein yield. Additionally, incorporating purification tags (such as His6) at either the N- or C-terminus will facilitate downstream purification steps.

How do mutations in Canis simensis MT-CO1 correlate with mitochondrial dysfunction and evolutionary adaptation?

Mutations in Canis simensis MT-CO1 can significantly impact mitochondrial function while potentially reflecting evolutionary adaptations to the high-altitude environment of the Ethiopian Highlands. Research examining these relationships should consider:

  • Functional impact analysis: Non-synonymous mutations in highly conserved regions of MT-CO1 generally have deleterious effects on enzyme activity and assembly. Studies in other species have shown that such mutations can reduce complex IV activity by disrupting electron transfer or proton pumping pathways .

  • Adaptation signatures: Some MT-CO1 variations in Canis simensis may represent adaptive responses to hypoxic conditions in high-altitude environments. Comparative analysis with lowland canids can identify positive selection signatures in specific protein domains.

  • Pathological implications: Mutations affecting MT-CO1 function are associated with mitochondrial diseases in other species, including metabolic disorders and neurodegeneration . These pathologies would manifest as reduced ATP production, increased reactive oxygen species generation, and compromised tissue function, particularly in energy-demanding organs.

  • Conservation genetics: The pattern of MT-CO1 mutations across isolated Canis simensis populations provides insights into genetic diversity and inbreeding depression risks in this endangered species.

Mutation TypeFunctional ConsequencePotential Adaptive Significance
Synonymous mutationsGenerally neutral; may affect mRNA stability or translation efficiencyMay indicate selective pressure on codon usage
Conservative missense mutationsMinimal impact on protein functionMay fine-tune protein activity for environmental conditions
Non-conservative missense mutationsOften deleterious to protein function; may disrupt complex assemblyRarely adaptive unless in specific functional domains related to environmental adaptation
Mutations in binding domainsAltered interaction with other complex IV subunits or assembly factorsMay modify respiratory chain efficiency under specific metabolic conditions

What are the optimal experimental conditions for assessing recombinant Canis simensis MT-CO1 enzymatic activity?

Measuring the enzymatic activity of recombinant Canis simensis MT-CO1 requires careful experimental design that accounts for the protein's natural membrane environment and complex assembly requirements. The following methodology is recommended:

  • Reconstitution approach: Since MT-CO1 functions as part of Complex IV, it should be reconstituted with other complex subunits in liposomes or nanodiscs to recreate the native environment. This requires either co-expression or separate purification and subsequent assembly of components.

  • Activity measurement: Cytochrome c oxidase activity can be measured spectrophotometrically by monitoring the oxidation of reduced cytochrome c at 550 nm. The reaction buffer should maintain physiological conditions:

    • 50 mM phosphate buffer (pH 7.2-7.4)

    • 50 μM reduced cytochrome c

    • Temperature control at 37°C (or 38.5°C to match canid body temperature)

    • Presence of 0.1% dodecyl maltoside or other suitable detergent if working with the membrane-embedded enzyme

  • Inhibition studies: Specific inhibitors like potassium cyanide (KCN) or sodium azide should be used as controls to confirm that measured activity is specifically due to cytochrome c oxidase.

  • Oxygen consumption: Complementary measurements using oxygen electrodes (Clark-type) can provide direct evidence of enzyme function by monitoring oxygen consumption rates in the presence of reduced cytochrome c.

  • Data analysis: Activity should be expressed as rate of cytochrome c oxidation (μmol of cytochrome c oxidized per minute per mg of enzyme) or as turnover number (molecules of substrate converted per enzyme molecule per second).

How does the binding interaction between Canis simensis MT-CO1 mRNA and translation factors differ from other canids?

Understanding the unique binding interactions between Canis simensis MT-CO1 mRNA and translation factors requires sophisticated molecular techniques and comparative analysis. Research has shown that mitochondrial translation relies on specific protein-RNA interactions for efficient protein synthesis, as evidenced by studies on translational activators like TACO1 .

For investigating these interactions in Canis simensis:

  • RNA structure analysis: The secondary structure of MT-CO1 mRNA can be determined using SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) or DMS-seq to identify potential regulatory elements and binding sites that may differ from other canids.

  • Protein-RNA interaction mapping: Techniques such as RNA-EMSA (RNA Electrophoretic Mobility Shift Assay) can identify specific regions of MT-CO1 mRNA that interact with translational activators . As demonstrated in previous research, TACO1 binds multiple distinct regions of the mt-Co1 mRNA, suggesting cumulative binding at multiple sites enables efficient translation .

  • Cross-linking and immunoprecipitation: CLIP-seq techniques can identify in vivo binding sites of translational factors on MT-CO1 mRNA with nucleotide resolution.

  • Ribosome profiling: This technique can reveal translational efficiency and pausing sites specific to Canis simensis MT-CO1 compared to other canids.

  • Comparative analysis: Alignment of binding sites across canid species can identify conserved and divergent elements that may reflect adaptation to different environmental conditions or metabolic requirements.

TechniqueApplicationExpected Results
RNA-EMSAIdentification of protein binding sitesMigration shifts of labeled RNA fragments upon protein binding
RIP-seqIn vivo RNA-protein interaction mappingEnrichment of specific mRNA regions in immunoprecipitated samples
Ribosome profilingTranslation efficiency analysisRibosome density patterns across the mRNA sequence
ToeprintingPrecise mapping of ribosome binding sitesIdentification of translation initiation sites and ribosome pausing positions
RNA structural probingSecondary structure determinationReactivity profiles indicating single- and double-stranded regions

What are the implications of MT-CO1 variations for understanding the evolutionary history and conservation of Canis simensis?

MT-CO1 sequence variations provide critical insights into both the evolutionary history and conservation status of Canis simensis, one of Africa's most endangered carnivores:

  • Phylogeographic patterns: MT-CO1 haplotype distribution across the fragmented range of Canis simensis can reveal historical population connectivity, isolation events, and potential glacial refugia in the Ethiopian Highlands. This information helps reconstruct the species' response to past climate changes.

  • Genetic diversity assessment: Nucleotide diversity indices (π and θ) calculated from MT-CO1 sequences provide measures of genetic diversity that can be compared across populations and with other canids. Low diversity may indicate historical bottlenecks or recent inbreeding.

  • Selection pressure analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) in MT-CO1 can identify regions under purifying or positive selection, potentially related to the species' adaptation to high-altitude environments.

  • Conservation unit delineation: MT-CO1 variation patterns can assist in defining Evolutionarily Significant Units (ESUs) and Management Units (MUs) for conservation planning, ensuring that distinct genetic lineages are preserved.

  • Hybridization detection: MT-CO1 sequences can identify potential hybridization with domestic dogs or other canids, which represents a significant threat to this endangered species.

Researchers should interpret MT-CO1 data in conjunction with nuclear markers to account for sex-biased dispersal patterns and provide a more comprehensive picture of population structure and gene flow.

What protocols ensure optimal quality control for recombinant Canis simensis MT-CO1 production?

Ensuring high quality of recombinant Canis simensis MT-CO1 requires rigorous quality control measures throughout the production process:

  • Sequence verification: Before expression, confirm the MT-CO1 sequence through bidirectional Sanger sequencing to ensure no mutations have been introduced during cloning. Compare against reference sequences from GenBank or other databases.

  • Expression monitoring: Track protein expression using:

    • Western blotting with specific antibodies against MT-CO1 or incorporated tags

    • SDS-PAGE analysis with Coomassie staining for total protein visualization

    • In-gel heme staining to specifically detect heme-containing proteins like cytochrome c oxidase

  • Purity assessment:

    • Use size-exclusion chromatography (SEC) to analyze protein homogeneity

    • Employ multi-angle light scattering (MALS) to determine absolute molecular weight and aggregation state

    • Assess purity by mass spectrometry, aiming for >95% purity with minimal contaminants

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal stability assessment through differential scanning fluorimetry (DSF)

    • Limited proteolysis to ensure proper folding (properly folded proteins show characteristic resistance patterns)

  • Functional validation:

    • Cytochrome c oxidation assay as described in question 2.2

    • Oxygen consumption measurements

    • Binding assays with known interaction partners

Quality Control ParameterMethodAcceptance Criteria
Sequence identityDNA sequencing100% match to reference sequence
Protein puritySDS-PAGE/SEC-MALS>95% purity, single peak on SEC
Secondary structureCD spectroscopySpectrum consistent with predicted alpha-helical content
Thermal stabilityDSFTm within 5°C of native protein
Enzymatic activityCytochrome c oxidationActivity ≥80% of positive control
Endotoxin levelsLAL assay<0.1 EU/mg for research applications

How can researchers optimize PCR-based detection methods for Canis simensis MT-CO1 in environmental samples?

Detecting Canis simensis MT-CO1 in environmental samples (eDNA) presents unique challenges that require optimized PCR protocols:

  • Primer design strategy:

    • Design species-specific primers targeting regions of MT-CO1 that differ from closely related species, particularly domestic dogs and jackals

    • Optimal primer length: 18-25 nucleotides

    • Target amplicon size: 100-250 bp for environmental samples (shorter fragments are more likely to be recovered from degraded DNA)

    • In silico validation against all potential canids in the region to ensure specificity

  • Sample collection and preservation:

    • For fecal samples: collect fresh samples and store in 95% ethanol or specialized preservation buffers

    • For soil/water: filter environmental samples immediately after collection and preserve filters at -20°C

    • Process samples within 24-48 hours to minimize DNA degradation

  • DNA extraction optimization:

    • Use extraction protocols specifically designed for environmental samples with inhibitor removal steps

    • Include multiple negative controls to monitor contamination

    • Consider using magnetic bead-based extraction methods for automation and higher yield

  • PCR optimization:

    • Employ touchdown PCR protocols to increase specificity

    • Add PCR enhancers like BSA (0.4-0.8 μg/μL) to overcome inhibition

    • Optimize cycling conditions based on empirical testing with known positive samples

    • Use hot-start DNA polymerases to reduce non-specific amplification

  • Verification methods:

    • Confirm positives through Sanger sequencing of amplicons

    • Develop qPCR assays with specific probes for increased sensitivity and specificity

    • Consider digital PCR for absolute quantification in low-concentration samples

Optimization ParameterRecommendationRationale
Annealing temperatureUse gradient PCR to determine optimal temperatureMaximizes specificity while maintaining sensitivity
MgCl₂ concentrationTest range from 1.5-3.5 mMAffects polymerase activity and primer binding
DNA template amount1-5 μL of extracted DNABalance between inhibition and detection probability
Cycle number35-45 cyclesHigher cycle numbers for environmental samples with low target concentration
Amplicon verificationSequencing + BLAST analysisConfirms true positives and eliminates false positives

What are the best approaches for analyzing MT-CO1 protein-protein interactions within the respiratory complex?

Investigating protein-protein interactions of Canis simensis MT-CO1 within the respiratory complex requires a multi-technique approach that preserves the native membrane environment:

  • Crosslinking mass spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers like DSS or BS3 to stabilize transient interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides using specialized software (e.g., xQuest, pLink)

    • Map interaction sites to structural models to validate physiological relevance

  • Co-immunoprecipitation studies:

    • Use antibodies against MT-CO1 or epitope tags for pulldown experiments

    • Employ mild detergents (digitonin or LMNG) to maintain complex integrity

    • Identify interacting partners through mass spectrometry

    • Validate key interactions with reciprocal co-IPs using antibodies against identified partners

  • Proximity labeling techniques:

    • Generate MT-CO1 fusions with proximity labeling enzymes (BioID or APEX2)

    • Express in cell lines to label proximal proteins in the native environment

    • Identify labeled proteins through streptavidin pulldown and mass spectrometry

    • This approach captures both stable and transient interactions in the native context

  • Cryo-electron microscopy:

    • Purify intact respiratory complexes or supercomplexes

    • Analyze by single-particle cryo-EM to determine structural arrangements

    • Dock atomic models to identify interaction interfaces

    • Compare with structures from other species to identify Canis simensis-specific features

  • Förster resonance energy transfer (FRET):

    • Generate fluorescently labeled interacting partners

    • Measure energy transfer as evidence of proximity (<10 nm)

    • Particularly useful for dynamic interaction studies in living cells

Research has demonstrated that techniques like immunoprecipitation following crosslinking effectively capture associations between translational machinery components and mitochondrial mRNAs, as shown with TACO1 and its association with mitochondrial ribosomes .

How can researchers differentiate between pathological mutations and neutral polymorphisms in Canis simensis MT-CO1?

Distinguishing pathological mutations from neutral polymorphisms in Canis simensis MT-CO1 requires an integrated approach combining evolutionary analysis, structural biology, and functional studies:

  • Conservation analysis:

    • Calculate conservation scores across canids and broader mammalian lineages

    • Highly conserved residues are more likely to be functionally important

    • Use tools like SIFT, PolyPhen-2, or PROVEAN to predict functional impact based on conservation

    • Mutations in sites with conservation scores >0.8 across mammals warrant further investigation

  • Structural impact prediction:

    • Map mutations onto structural models of MT-CO1

    • Assess proximity to functional sites: heme groups, proton channels, or subunit interfaces

    • Evaluate changes in physicochemical properties (charge, hydrophobicity, size)

    • Use molecular dynamics simulations to predict structural perturbations

  • Population genetics approach:

    • Calculate frequency of variants across populations

    • Common variants (>1% frequency) are less likely to be pathological

    • Apply neutrality tests (Tajima's D, Fu's Fs) to identify regions under selection

    • Compare with patterns observed in other canid species

  • Functional validation:

    • Generate recombinant proteins with candidate mutations

    • Assess enzymatic activity using methods described in section 2.2

    • Measure complex assembly efficiency through blue native PAGE

    • Evaluate impacts on mitochondrial membrane potential and ATP production

  • Disease association studies:

    • Correlate specific mutations with phenotypic data from wild populations

    • Look for associations with reduced fitness, reproductive success, or specific pathologies

    • Similar mutations in other species (especially humans) with known pathological outcomes provide supporting evidence

Analysis TypePathological IndicatorNeutral Indicator
ConservationHigh conservation across distant taxaVariable across related species
Structural locationActive sites, subunit interfacesSurface exposed, away from functional sites
Population frequencyRare variants (<1%)Common polymorphisms
Physicochemical changeMajor alteration in propertiesConservative substitutions
Functional impact>30% reduction in enzyme activity<10% impact on activity

How can CRISPR/Cas9 technology be applied to study MT-CO1 function in canid cell lines?

CRISPR/Cas9 technology offers powerful approaches for studying MT-CO1 function in canid cell lines, despite challenges associated with targeting mitochondrial DNA:

  • Mitochondrial base editors (MBEs):

    • Target specific nucleotides in mtDNA using DddA-derived cytosine base editors fused to mitochondrial-targeted TALE arrays

    • Design TALE arrays specific to Canis simensis MT-CO1 sequences

    • Introduce precise C-to-T conversions without double-strand breaks

    • Create specific mutations observed in wild populations to assess their functional impact

  • Nuclear-encoded MT-CO1 expression systems:

    • Generate nuclear versions of MT-CO1 with modified codons but identical amino acid sequence

    • Add mitochondrial targeting sequence for proper localization

    • Use standard CRISPR/Cas9 to edit the nuclear version

    • This approach allows standard genome editing techniques while studying MT-CO1 function

  • CRISPR interference for MT-CO1 regulation:

    • Target nuclear factors that regulate MT-CO1 expression or translation

    • Use CRISPRi to downregulate TACO1 or other translation factors

    • Create hypomorphic phenotypes that partially reduce MT-CO1 levels

    • This approach circumvents difficulties in directly editing mtDNA

  • Mitochondrial transplantation:

    • Isolate mitochondria from different Canis simensis populations with natural MT-CO1 variants

    • Transplant into recipient canid cells after depleting native mitochondria

    • Create cybrid (cytoplasmic hybrid) cell lines to study variant effects in controlled nuclear background

  • Single-cell analysis of MT-CO1 variants:

    • Use CRISPR screens targeting nuclear factors

    • Apply single-cell transcriptomics and proteomics to characterize effects

    • Identify compensatory mechanisms for MT-CO1 dysfunction

TechniqueAdvantagesLimitationsApplications
Mitochondrial base editorsDirect mtDNA editingLimited to C-to-T editsIntroducing specific point mutations
Nuclear MT-CO1 expressionUses standard CRISPR techniquesMay not fully recapitulate native regulationStructure-function studies
CRISPRi targeting regulatorsAdjustable repression levelsIndirect effectsStudying translation regulation
Mitochondrial transplantationStudies natural variantsTechnical complexityPopulation variant analysis

What role does MT-CO1 play in the adaptation of Canis simensis to high-altitude environments?

The role of MT-CO1 in the adaptation of Canis simensis to high-altitude environments represents an important research direction, particularly as this species inhabits the Ethiopian Highlands at elevations up to 4,500 meters:

  • Comparative genomic analysis:

    • Compare MT-CO1 sequences between highland and lowland canid populations

    • Identify convergent evolution patterns with other high-altitude adapted mammals (e.g., snow leopards, Tibetan wolves)

    • Calculate dN/dS ratios to detect positive selection signatures

    • Focus on amino acid sites that interact with oxygen or influence enzyme efficiency

  • Functional characterization:

    • Measure oxygen affinity of recombinant MT-CO1 variants under different oxygen tensions

    • Compare enzyme kinetics (Km, Vmax) between highland and lowland variants

    • Assess thermal stability and pH sensitivity differences that might relate to environmental adaptation

    • Determine if variants show different susceptibility to inhibition by reactive nitrogen species (common in hypoxic conditions)

  • Physiological studies:

    • Measure mitochondrial respiration in cells expressing different MT-CO1 variants

    • Assess reactive oxygen species production under normoxic versus hypoxic conditions

    • Determine if variants show differential responses to hypoxia-inducible factor (HIF) pathway activation

    • Examine coupling efficiency between electron transport and ATP production

  • Population genetics approach:

    • Calculate haplotype diversity across elevation gradients

    • Test for correlation between specific variants and elevation

    • Apply environmental association analysis to identify altitude-adaptive mutations

    • Estimate timeframe of adaptive evolution using molecular clock approaches

  • Comparative physiology:

    • Analyze whole-organism metrics (metabolic rate, thermogenesis, exercise capacity)

    • Compare physiological parameters between individuals with different MT-CO1 haplotypes

    • Assess whether specific variants correlate with improved performance under hypoxic conditions

Adaptation MechanismExpected MT-CO1 ModificationPhysiological Consequence
Increased oxygen affinityMutations near heme binding sitesMore efficient oxygen utilization in hypoxic conditions
Reduced ROS productionModifications in electron transfer pathwayDecreased oxidative damage during hypoxic stress
Enhanced proton pumpingChanges in proton channel residuesMaintained ATP production despite low oxygen
Thermal stabilitySurface residue modificationsAdaptation to temperature fluctuations at high altitudes

How can researchers address common challenges in expressing and purifying functional recombinant Canis simensis MT-CO1?

Expressing and purifying functional recombinant Canis simensis MT-CO1 presents several challenges due to its hydrophobic nature and requirement for cofactors. The following troubleshooting strategies address common issues:

  • Protein aggregation and inclusion body formation:

    • Use mild detergents (DDM, LMNG) or amphipols for extraction and purification

    • Express at lower temperatures (16-20°C) to slow folding and prevent aggregation

    • Consider fusion tags that enhance solubility (MBP, SUMO) at the N-terminus

    • Employ gradient purification methods that separate aggregates from properly folded protein

    • Use screening approaches to identify optimal buffer conditions that maintain protein stability

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Consider using specialized strains with additional tRNAs for rare codons

    • Test induction parameters (inducer concentration, time, temperature)

    • Supplement growth media with heme precursors (δ-aminolevulinic acid) to support cofactor incorporation

    • Use dual promoter systems for coordinated expression of assembly factors

  • Improper cofactor incorporation:

    • Supplement expression media with heme

    • Co-express heme synthesis enzymes or transport proteins

    • Verify heme incorporation through spectroscopic analysis (absorption spectrum between 400-650 nm)

    • Consider in vitro reconstitution with purified heme if co-translational incorporation is insufficient

  • Incomplete complex assembly:

    • Co-express essential assembly factors identified in mitochondrial systems

    • Use tandem affinity purification to isolate completely assembled complexes

    • Verify assembly state through blue native PAGE and activity assays

    • Consider expressing minimal functional units rather than the entire complex IV

  • Protein instability during purification:

    • Maintain 4°C throughout all purification steps

    • Include protease inhibitors and reducing agents in all buffers

    • Minimize exposure to air; consider using vacuum or nitrogen-purged buffers

    • Add stabilizing agents like glycerol (10-15%) or specific lipids to buffers

    • Proceed to functional assays immediately after purification

ChallengeTroubleshooting ApproachSuccess Indicator
AggregationScreen detergent:protein ratios; use GFP fusion to monitor aggregationMonodisperse peak on size exclusion chromatography
Low expressionTest multiple expression systems; optimize induction conditionsVisible band on SDS-PAGE; positive western blot signal
Improper foldingChaperone co-expression; controlled slow foldingSecondary structure verification by CD spectroscopy
Heme incorporationSupplement with δ-ALA and iron; verify spectroscopicallyCharacteristic absorption peaks at 440-460 nm
DegradationOptimize buffer pH and ionic strength; add stabilizersSingle band on SDS-PAGE after 24h at 4°C

What strategies help resolve data interpretation challenges when comparing MT-CO1 sequences across canid species?

Comparing MT-CO1 sequences across canid species presents several data interpretation challenges that require careful analytical approaches:

  • Sequence alignment optimization:

    • Use translation alignment (aligning amino acids, then reverting to nucleotides) for improved accuracy

    • Apply alignment algorithms specifically designed for coding sequences

    • Manually inspect and refine alignments in regions with insertions/deletions

    • Consider structural information to guide alignment of functionally important regions

    • Use multiple alignment algorithms and compare results to identify consistent patterns

  • Homoplasy vs. homology differentiation:

    • Employ substitution models that account for codon bias and transitions/transversions

    • Use likelihood ratio tests to select the most appropriate evolutionary model

    • Apply tests for saturation to identify regions where multiple substitutions may have occurred

    • Consider using amino acid-based analyses for deep divergences to reduce homoplasy

    • Analyze synonymous and non-synonymous sites separately

  • Incomplete lineage sorting resolution:

    • Generate multiple gene trees to identify discordant patterns

    • Apply coalescent-based methods that account for incomplete lineage sorting

    • Use Bayesian approaches that integrate over parameter uncertainty

    • Compare mitochondrial and nuclear phylogenies to identify introgression events

    • Consider demographic history when interpreting divergence patterns

  • Reference sequence selection:

    • Use multiple reference sequences to avoid bias

    • Ensure reference sequences are correctly annotated and error-free

    • When possible, generate new high-quality reference sequences from well-characterized specimens

    • For Canis simensis, generate population-specific reference sequences to capture intraspecific variation

  • Functional vs. neutral variation interpretation:

    • Map variants to protein structure to assess potential functional impacts

    • Use selection tests (McDonald-Kreitman, dN/dS) to identify regions under selection

    • Compare patterns across different canid lineages to identify convergent evolution

    • Integrate experimental data on variant effects with sequence analysis

    • Consider the modular nature of MT-CO1 when interpreting variation patterns

Analysis ChallengeRecommended ApproachExpected Outcome
Alignment ambiguityTranslation alignment with MAFFT G-INS-iImproved alignment of coding regions with conservation of reading frame
Substitution saturationTest with DAMBE; use appropriate modelsIdentification of regions suitable for phylogenetic inference
Phylogenetic uncertaintyBayesian analysis with posterior probability assessmentRobust support values and identification of ambiguous relationships
Introgression detectionCompare mtDNA and nuclear DNA patternsIdentification of discordant patterns suggesting hybridization
Selection pattern analysisBranch-site models in PAML or HyPhyDetection of episodic or lineage-specific selection

How might advances in structural biology enhance our understanding of Canis simensis MT-CO1 function?

Recent advances in structural biology techniques offer unprecedented opportunities to elucidate the detailed function of Canis simensis MT-CO1:

  • Cryo-electron microscopy applications:

    • Single-particle cryo-EM can resolve structures of intact respiratory complexes at near-atomic resolution

    • Compare structures of MT-CO1 from Canis simensis with those from other canids to identify species-specific features

    • Capture different conformational states to understand the catalytic cycle

    • Visualize interactions with assembly factors and translational regulators like TACO1

    • Combine with mutagenesis to determine structure-function relationships of variant residues

  • Integrative structural approaches:

    • Combine cryo-EM with mass spectrometry to identify post-translational modifications

    • Utilize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamics and conformational changes

    • Apply crosslinking mass spectrometry to determine interaction interfaces with other subunits

    • Use solid-state NMR for specific regions of interest within the protein

    • Develop computational models validated by experimental constraints

  • Time-resolved structural techniques:

    • Apply time-resolved cryo-EM to capture transient states during electron transfer

    • Use temperature-jump methods coupled with spectroscopy to observe conformational changes

    • Employ stopped-flow techniques to observe rapid binding events

    • Develop methods to visualize proton translocation in real-time

    • These approaches can reveal previously unobservable mechanistic details of MT-CO1 function

  • In situ structural determination:

    • Cryo-electron tomography of mitochondria from Canis simensis cells

    • Visualize MT-CO1 within native supercomplexes in the mitochondrial membrane

    • Correlative light and electron microscopy to link structure with function

    • In-cell NMR to study dynamics in native environment

    • These methods bridge the gap between isolated protein studies and cellular function

  • Computational advances:

    • Use AlphaFold2 or RoseTTAFold to predict structures of variant forms

    • Apply molecular dynamics simulations to study conformational changes and energy landscapes

    • Develop machine learning approaches to identify structural determinants of oxygen affinity

    • Quantum mechanical/molecular mechanical (QM/MM) calculations to model electron transfer

Structural TechniqueApplication to MT-CO1Expected Insights
Single-particle cryo-EMWhole complex IV structureSubunit interactions, conformational states
Cryo-electron tomographyIn situ visualizationNative arrangement in supercomplexes
HDX-MSDynamics mappingIdentification of flexible regions and allosteric sites
Solid-state NMRSpecific domain analysisDetailed structure of transmembrane regions
Molecular dynamicsSimulation of variantsImpact of mutations on protein dynamics and stability

What are the potential applications of MT-CO1 research in wildlife conservation efforts for Canis simensis?

Research on MT-CO1 in Canis simensis has several important applications for conservation efforts of this endangered species:

  • Non-invasive monitoring techniques:

    • Develop MT-CO1 markers for species identification from environmental DNA (eDNA)

    • Create PCR-based assays to monitor presence/absence in different habitats

    • Establish protocols for fecal DNA analysis to estimate population size and distribution

    • These methods reduce the need for direct capture and handling of this endangered species

  • Population genetic health assessment:

    • Use MT-CO1 haplotype diversity as an indicator of genetic health

    • Establish baseline measures of genetic diversity across remaining populations

    • Monitor changes in diversity over time to detect population decline or recovery

    • Integrate with nuclear markers to develop comprehensive genetic management plans

  • Hybridization detection and management:

    • Develop MT-CO1 markers that distinguish between Canis simensis and domestic dogs

    • Create rapid field testing kits for hybridization detection

    • Implement genetic monitoring programs in areas with high domestic dog presence

    • Design evidence-based management strategies to reduce hybridization threat

  • Adaptive capacity prediction:

    • Assess functional variation in MT-CO1 related to environmental adaptation

    • Identify populations with variants potentially beneficial under climate change scenarios

    • Develop predictive models linking genetic variation to population resilience

    • Guide translocation efforts based on adaptive genetic profiles

  • Disease susceptibility assessment:

    • Investigate links between MT-CO1 variants and disease resistance

    • Monitor emergence of potentially deleterious mutations in small populations

    • Develop genetic risk assessments for pathogen exposure

    • Guide veterinary interventions based on genetic susceptibility profiles

Conservation ApplicationMT-CO1 Research ContributionPractical Implementation
Population monitoringSpecies-specific primers for eDNA analysisField kits for ranger use in protected areas
Genetic diversity assessmentHaplotype identification and catalogingDatabase of regional genetic profiles
Hybridization managementDiagnostic markers for hybrid detectionRapid testing protocols for field use
Climate change adaptation planningFunctional analysis of high-altitude adaptationsPredictive models for population viability
Disease managementIdentification of susceptibility variantsTargeted vaccination programs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.