Recombinant Canis simensis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Canis simensis (Ethiopian wolf) (Simenia simensis)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLILYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMATRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, comprised of heme A3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MT-CO2 in Canis simensis?

Cytochrome c oxidase subunit 2 (MT-CO2) in the Ethiopian wolf (Canis simensis) is a critical component of the electron transport chain in cellular respiration. As in other species, this protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for ATP production . The protein is encoded by the mitochondrial genome, and its conservation across species underscores its fundamental importance in energy metabolism. In C. simensis, as with other canids, MT-CO2 contributes to the highly efficient energy production systems that support their active hunting behaviors and adaptation to high-altitude environments .

How should recombinant Canis simensis MT-CO2 be stored and handled for optimal stability?

For optimal stability, recombinant Canis simensis MT-CO2 should be stored in a Tris-based buffer with 50% glycerol . The recommended storage temperature is -20°C, with extended storage preferably at -20°C or -80°C to maintain protein integrity . Researchers should avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week .

When handling the protein, maintain sterile conditions and use appropriate protective equipment to prevent contamination. Thaw aliquots on ice and centrifuge briefly before opening the tube to collect any protein that may have adhered to the cap. For applications requiring buffer exchange or concentration adjustment, consider using dialysis or centrifugal filter units with appropriate molecular weight cut-offs.

What experimental approaches are most effective for studying MT-CO2 evolutionary patterns in Canis simensis compared to other canids?

To effectively study MT-CO2 evolutionary patterns in the Ethiopian wolf compared to other canids, researchers should implement a multi-faceted approach:

  • Comparative Genomic Analysis: Sequence MT-CO2 genes from multiple individuals across different Canis populations. This approach has revealed significant interspecific variation in the genus Canis, with extensive gene flow between species . For C. simensis specifically, compare sequences with other canids to identify conservation patterns and unique adaptations.

  • Selection Analysis: Employ maximum likelihood models of codon substitution to estimate the ratio of nonsynonymous to synonymous substitutions (ω). This approach has identified both purifying selection (ω << 1) and potential positive selection in other species' COII genes . For C. simensis, similar analyses can reveal selective pressures unique to this endangered species.

  • Structural Biology Integration: Combine sequence analysis with protein structure prediction to identify how amino acid substitutions might affect function. Pay particular attention to sites involved in interactions with nuclear-encoded subunits of COX and cytochrome c.

  • Population Genetics: Analyze intraspecific variation within C. simensis populations, which can be particularly informative given the species' fragmented distribution across Ethiopian highlands above 3000m elevation .

This integrated approach has revealed significant evolutionary insights in other species, showing that while most COII codons are under strong purifying selection, approximately 4% may evolve under relaxed selective constraint .

How does altitude adaptation potentially affect MT-CO2 function in the Ethiopian wolf?

The Ethiopian wolf (Canis simensis) inhabits high-altitude environments, typically above 3000m in the Ethiopian highlands . This specialized habitat likely exerts selective pressure on genes involved in oxygen utilization and energy metabolism, including MT-CO2. To investigate altitude adaptation effects on MT-CO2 function:

  • Comparative Sequence Analysis: Compare MT-CO2 sequences between C. simensis and closely related canids from lower elevations. Focus on amino acid substitutions that might affect oxygen binding or electron transfer efficiency. Previous studies on high-altitude species have identified convergent adaptations in respiratory chain proteins.

  • Functional Assays: Develop in vitro enzyme activity assays comparing recombinant MT-CO2 from C. simensis with homologs from lowland canids under varying oxygen concentrations. Measure electron transfer rates and oxygen consumption to quantify potential functional differences.

  • Structural Analysis: Use molecular modeling to identify how C. simensis-specific amino acid substitutions might alter protein structure and function, particularly at sites interacting with oxygen or electron donors/acceptors.

  • Physiological Correlation: Correlate MT-CO2 sequence variations with physiological adaptations observed in the Ethiopian wolf, such as enhanced oxygen delivery or modified metabolic rates at high altitudes.

The recent discovery of a 1.6-1.4 million-year-old C. simensis fossil suggests the species has a long evolutionary history , potentially allowing sufficient time for the development of specialized adaptations to high-altitude environments.

What are the optimal expression systems for producing functional recombinant Canis simensis MT-CO2?

For producing functional recombinant Canis simensis MT-CO2, researchers should consider multiple expression systems, each with distinct advantages for different experimental applications:

Table 1: Comparison of Expression Systems for Recombinant C. simensis MT-CO2

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production
Insect cellsBetter folding, some post-translational modificationsMore complex culture requirements, moderate costFunctional studies, protein-protein interaction assays
Mammalian cellsNative-like post-translational modifications, proper foldingHigher cost, lower yield, longer production timeComplex functional studies, assays requiring authentic protein activity
Cell-free systemsRapid production, avoids toxicity issuesLower yields, higher costProduction of proteins toxic to host cells, rapid screening

When expressing MT-CO2, which normally requires mitochondrial insertion and interaction with other respiratory complex subunits, consider the following methodological approaches:

  • For E. coli systems, optimize codon usage for prokaryotic expression and consider fusion tags that enhance solubility (e.g., SUMO, MBP).

  • For functional studies, mammalian cell lines derived from canid species may provide the most relevant cellular environment with appropriate chaperones and interacting partners.

  • Include appropriate purification tags (His6, FLAG, etc.) that can be later removed by specific proteases if needed for functional studies.

  • Validate protein folding and function through activity assays measuring electron transfer capability in reconstituted systems.

The choice of expression system should align with the specific research objectives, whether focused on protein structure, evolutionary comparisons, or functional characterization.

How can researchers investigate the role of MT-CO2 in interspecific hybridization within the Canis genus?

Investigating MT-CO2's role in interspecific hybridization within Canis requires sophisticated approaches that address both genetic and functional aspects:

  • Comparative Genomic Analysis: Analyze MT-CO2 sequences from hybrid zones, particularly focusing on regions where Ethiopian wolves may interact with other canids. The genus Canis shows extensive evidence of interspecific hybridization throughout its evolutionary history . Specifically, hybridization has been documented between gray wolves and African golden wolves, with the latter possibly representing a hybrid species from gray wolf and Ethiopian wolf ancestors .

  • Cytonuclear Compatibility Analysis: Examine potential incompatibilities between mitochondrial-encoded MT-CO2 and nuclear-encoded interacting partners across species. This is particularly relevant as studies in other organisms have shown that mismatches between mitochondrial and nuclear genomes can affect fitness in hybrids .

  • Experimental Design for Functional Studies:

    • Create chimeric proteins combining MT-CO2 segments from different Canis species

    • Measure electron transport efficiency in reconstructed systems

    • Assess protein-protein interaction strengths between MT-CO2 variants and nuclear-encoded partners

    • Develop cellular models expressing different combinations of mitochondrial and nuclear genomes

  • Gene Flow Modeling: Develop models that incorporate MT-CO2 sequence data to estimate historical gene flow patterns within Canis. Previous research has identified extensive gene flow in the genus, including genetic contribution from unknown "ghost" canids into the ancestor of the gray wolf and coyote .

This research is particularly significant for understanding species boundaries and evolution within Canis, as hybridization has played a major role in shaping the genus, potentially including the very origin of certain species like the African golden wolf .

What methodological challenges exist in distinguishing selective pressures on MT-CO2 in small, isolated populations of Canis simensis?

Studying selective pressures on MT-CO2 in the Ethiopian wolf presents unique methodological challenges due to its endangered status and population structure:

  • Small Population Size Effects: With only ~500 individuals (~200 adults) across six isolated populations , genetic drift may overwhelm selection signals. Researchers must develop statistical approaches that can disentangle these processes. Methods include:

    • Calculating the effective population size (Ne) for each subpopulation

    • Employing models that account for demographic history

    • Using coalescent simulations to generate null distributions for selection statistics

  • Sampling Limitations: Limited sample availability from endangered populations requires optimized extraction methods for ancient DNA and non-invasive samples. Consider:

    • Developing protocols for fecal or hair sample DNA extraction

    • Utilizing museum specimens for historical genetic data

    • Designing capture techniques for MT-CO2 from degraded samples

    • Establishing strict anti-contamination protocols

  • Population Structure Analysis: The fragmented nature of C. simensis populations requires careful consideration:

    • Implement hierarchical testing for selection that accounts for population structure

    • Conduct parallel analyses within and between subpopulations

    • Compare results against simulated datasets that mirror the observed population structure

  • Comparative Framework Development: To identify selective pressures specific to C. simensis MT-CO2:

    • Develop null models based on neutral evolution

    • Compare patterns of variation with other mitochondrial genes

    • Utilize related canid species as outgroups to polarize evolutionary changes

The unique evolutionary history of C. simensis, now supported by fossil evidence dating to 1.6-1.4 Ma , provides an opportunity to study long-term selection patterns, but requires careful methodological design to overcome the limitations imposed by its current endangered status.

What are the implications of MT-CO2 variations for designing conservation strategies for the Ethiopian wolf?

MT-CO2 variations can significantly inform conservation strategies for the Ethiopian wolf through several avenues:

Table 2: Conservation Implications of MT-CO2 Variation Patterns

This multifaceted approach to considering MT-CO2 variation can strengthen conservation planning for this highly endangered species, whose minimum viable population size has been estimated at 3,876 individuals (95% CI: 2,261-5,095) , far above the current population of approximately 500.

What are the optimal protocols for extracting and amplifying MT-CO2 from limited Canis simensis samples?

Given the endangered status of the Ethiopian wolf, researchers must optimize protocols for extracting and amplifying MT-CO2 from limited and potentially degraded samples:

  • Sample Collection Optimization:

    • Non-invasive sampling techniques: Prioritize fecal samples, shed hair, or saliva from environmental sources

    • Proper preservation: Immediately store samples in silica gel, 95% ethanol, or specialized DNA preservation buffers

    • Field protocols: Collect samples during cooler times of day to minimize DNA degradation

    • Sampling strategy: Implement transect methods across different habitat types to maximize representation

  • DNA Extraction Methods:

    • For fecal samples: Use specialized kits designed for inhibitor removal (e.g., QIAamp DNA Stool Mini Kit with modifications)

    • For hair samples: Implement single-hair extraction protocols with extended digestion times

    • For degraded tissue: Apply ancient DNA techniques including silica-based purification

    • Quality control: Include multiple extraction blanks as negative controls

  • MT-CO2 Amplification Approach:

    • Design primers specific to conserved regions flanking C. simensis MT-CO2

    • Implement nested PCR approaches for highly degraded samples

    • Use high-fidelity polymerases to minimize error rates

    • Consider designing multiple overlapping amplicons for degraded DNA

  • Next-Generation Sequencing Integration:

    • Prepare libraries with unique molecular identifiers to control for PCR duplicates

    • Implement target enrichment approaches when working with degraded DNA

    • Use bioinformatic pipelines that can account for post-mortem DNA damage

    • Validate results through replicate sequencing

This methodological framework has been successfully applied to other endangered species and can be adapted specifically for C. simensis MT-CO2 analysis, enabling research while minimizing impact on this critically endangered population.

How can researchers effectively design experiments to study MT-CO2 interactions with nuclear-encoded proteins in Canis simensis?

Designing effective experiments to study interactions between mitochondrial-encoded MT-CO2 and nuclear-encoded proteins in Canis simensis requires sophisticated approaches:

  • In Silico Interaction Analysis:

    • Perform homology modeling of C. simensis MT-CO2 based on crystallographic structures from related species

    • Conduct molecular docking simulations with nuclear-encoded cytochrome c and other COX subunits

    • Identify key interaction interfaces and amino acid residues

    • Predict the impact of C. simensis-specific substitutions on binding affinity

  • Co-Immunoprecipitation Studies:

    • Express tagged versions of recombinant C. simensis MT-CO2 and potential interacting partners

    • Perform pull-down assays under various conditions to identify stable interactions

    • Validate interactions using reciprocal co-IP approaches

    • Compare interaction profiles with those of other canid species to identify species-specific differences

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs linking MT-CO2 and nuclear-encoded partners to complementary fragments of fluorescent proteins

    • Express these constructs in mammalian cell lines

    • Visualize interactions through reconstitution of fluorescent signal

    • Quantify interaction strength through fluorescence intensity measurements

  • Functional Reconstitution Assays:

    • Reconstitute partial or complete cytochrome c oxidase complexes using recombinant components

    • Measure electron transfer efficiency and oxygen consumption rates

    • Compare performance of complexes containing C. simensis MT-CO2 versus other canid homologs

    • Assess how C. simensis-specific substitutions affect functional parameters

These approaches can provide critical insights into how MT-CO2 interactions may have evolved in C. simensis as it adapted to its unique high-altitude environment and diverged from other canids. Such studies are particularly relevant given evidence of extensive gene flow between canid species throughout their evolutionary history .

What analytical frameworks best integrate MT-CO2 sequence data with ecological and physiological adaptations in the Ethiopian wolf?

Integrating MT-CO2 sequence data with ecological and physiological adaptations in the Ethiopian wolf requires sophisticated analytical frameworks that bridge molecular, organismal, and ecological scales:

  • Phylogenetic Comparative Methods:

    • Implement phylogenetic generalized least squares (PGLS) to correlate MT-CO2 sequence features with physiological traits across canids

    • Use ancestral state reconstruction to trace the evolution of key MT-CO2 residues alongside ecological niche shifts

    • Apply tests for convergent evolution to identify if MT-CO2 adaptations in C. simensis parallel those in other high-altitude adapted mammals

    • Quantify phylogenetic signal in both molecular and ecological traits to determine evolutionary constraints

  • Ecological Niche Modeling Integration:

    • Correlate MT-CO2 variants with environmental variables across the Ethiopian wolf's range

    • Implement bioclimate niche modeling similar to approaches used in paleoenvironmental reconstructions

    • Project how climate change scenarios might affect populations with different MT-CO2 variants

    • Develop models that incorporate both genetic and environmental data to predict population persistence

  • Physiological Performance Correlation:

    • Design respirometry studies to measure oxygen consumption in individuals with different MT-CO2 haplotypes

    • Correlate MT-CO2 sequence variations with measurable physiological parameters (e.g., hemoglobin oxygen affinity, maximal metabolic rate)

    • Implement field metabolic measurements using doubly labeled water techniques

    • Develop ex vivo assays to measure mitochondrial performance in tissue samples from different populations

  • Multi-omics Data Integration:

    • Combine MT-CO2 sequence data with:

      • Transcriptomic data from relevant tissues

      • Proteomic analyses of respiratory complexes

      • Metabolomic profiles reflecting energy metabolism

    • Apply network analysis to identify coordinated changes across biological scales

    • Develop machine learning approaches to identify patterns connecting genotype to phenotype

This integrative analytical framework can reveal how MT-CO2 variations contribute to the Ethiopian wolf's remarkable adaptation to high-altitude environments while informing conservation efforts for this endangered species, which has persisted in Africa for at least 1.6-1.4 million years based on fossil evidence .

What emerging technologies could advance our understanding of MT-CO2 function in the conservation of Canis simensis?

Several emerging technologies hold promise for advancing our understanding of MT-CO2 function in Ethiopian wolf conservation:

  • Single-cell and Single-molecule Technologies:

    • Single-cell RNA sequencing to examine cell-specific expression patterns of nuclear genes interacting with MT-CO2

    • Single-molecule imaging to visualize real-time electron transfer in reconstructed respiratory complexes

    • Patch-clamp techniques applied to isolated mitochondria to measure membrane potential changes related to MT-CO2 function

    • These approaches can reveal cellular heterogeneity in energy metabolism that may affect fitness in different environments

  • CRISPR-based Mitochondrial Genome Editing:

    • Recently developed mitochondrial base editors could allow introduction of C. simensis MT-CO2 variants into cellular models

    • Creation of cybrid cell lines containing C. simensis mitochondria with nuclear backgrounds from different canids

    • Engineered cells could be subjected to varying oxygen levels and temperatures to simulate environmental conditions

    • These tools would enable direct testing of how specific MT-CO2 variants affect cellular physiology

  • Advanced Environmental DNA (eDNA) Monitoring:

    • High-throughput sequencing of environmental samples from Ethiopian wolf habitats

    • Targeted capture of MT-CO2 fragments from water, soil, and other environmental sources

    • Non-invasive population monitoring through scat-derived eDNA

    • These methods could provide comprehensive population-level data without disturbing this endangered species

  • Integrative Spatial Genomics:

    • Combine geospatial data with genomic information to map MT-CO2 variant distributions

    • Correlate variant frequencies with fine-scale environmental parameters

    • Implement landscape genomics approaches to identify selection pressures acting on MT-CO2

    • These spatial frameworks can inform protected area design and management strategies

These technologies, when applied to studying MT-CO2 in the Ethiopian wolf, can provide unprecedented insights into functional adaptations while minimizing impact on this endangered species, which has an estimated minimum viable population size of 3,876 individuals compared to its current population of only approximately 500.

How might comparative analyses of MT-CO2 across the Canidae family inform evolutionary models of protein co-adaptation?

Comparative analyses of MT-CO2 across Canidae offer unique opportunities for understanding protein co-adaptation evolutionary models:

  • Cytonuclear Co-evolution Frameworks:

    • Track coordinated changes between MT-CO2 and nuclear-encoded interacting partners across the Canidae phylogeny

    • Implement statistical models to detect coupled substitutions between mitochondrial and nuclear genomes

    • Estimate the timing of compensatory mutations following MT-CO2 sequence changes

    • This approach can reveal how mitochondrial and nuclear genomes maintain functional compatibility despite divergence

  • Hybrid Zone Natural Experiments:

    • Analyze MT-CO2 sequence and function across canid hybrid zones, particularly where Ethiopian wolves may interact with other canids

    • Measure fitness consequences of mismatched mitochondrial and nuclear genomes in hybrids

    • Assess selection against incompatible cytonuclear combinations

    • The genus Canis shows extensive evidence of past hybridization , providing natural experiments in cytonuclear compatibility

  • Molecular Evolution Rate Heterogeneity:

    • Compare evolutionary rates of MT-CO2 across different Canidae lineages

    • Correlate rate variations with ecological factors and population histories

    • Apply branch-site models to detect shifts in selective pressures

    • In other species, COII shows evidence of both strong purifying selection and potentially positively selected sites

  • Structural Biology Integration:

    • Map sequence variations onto structural models of the cytochrome c oxidase complex

    • Identify co-evolving residue networks that maintain structural integrity

    • Predict how compensatory mutations restore function after potentially disruptive changes

    • Validate predictions through in vitro mutagenesis and functional assays

Table 3: MT-CO2 Evolution Patterns Across Canidae

Evolutionary PatternTheoretical ImplicationMethodological ApproachExpected Signature in Data
Coordinated evolution with nuclear genesCompensation to maintain functionAnalysis of substitution correlationStatistical coupling between mitochondrial and nuclear substitutions
Lineage-specific accelerationAdaptation to new ecological nichesBranch-site models of selectionω > 1 on specific branches with ecological shifts
Conservation of interaction interfacesFunctional constraint on protein-protein interactionsStructural mapping of conserved sitesStrong purifying selection at binding interfaces
Convergent evolution in distantly related speciesSimilar selective pressures driving parallel adaptationsTests for molecular convergenceSame amino acid substitutions in unrelated lineages under similar conditions

These comparative analyses can inform broader evolutionary theory regarding how interacting proteins co-evolve while maintaining critical functions, using the diverse Canidae family—with its well-documented history of hybridization and adaptation to varied environments—as a natural laboratory.

What potential applications exist for recombinant MT-CO2 in developing novel conservation monitoring approaches for Canis simensis?

Recombinant MT-CO2 enables innovative conservation monitoring approaches for the Ethiopian wolf:

  • Immunoassay-Based Population Monitoring:

    • Develop antibodies against C. simensis MT-CO2-specific epitopes using recombinant protein

    • Create field-deployable lateral flow assays for rapid species identification from scat samples

    • Design quantitative ELISAs to assess population density from environmental samples

    • Implementation workflow:

      1. Produce recombinant MT-CO2 with species-specific epitopes

      2. Generate and validate antibodies against unique regions

      3. Develop optimized sample collection protocols

      4. Deploy in field settings with minimal equipment requirements

  • Aptamer-Based Biosensors:

    • Select DNA/RNA aptamers that specifically bind C. simensis MT-CO2

    • Develop electrochemical or optical biosensors for field detection

    • Create environmental monitoring devices for water sources frequented by Ethiopian wolves

    • This approach could provide real-time population monitoring with minimal disturbance

  • MT-CO2 Variant-Specific Molecular Assays:

    • Design high-resolution melt curve analyses to identify population-specific MT-CO2 variants

    • Develop multiplexed qPCR assays for simultaneous detection of multiple variants

    • Create microfluidic devices for field-based genetic monitoring

    • These technologies could track population connectivity and genetic diversity with rapid turnaround

  • Environmental Metabarcoding Applications:

    • Design MT-CO2-specific markers for metabarcoding from environmental DNA

    • Develop bioinformatic pipelines optimized for low-abundance target detection

    • Implement seasonal monitoring protocols across the Ethiopian highlands

    • This approach could monitor population distributions across the fragmented habitat range

Table 4: Comparison of MT-CO2-Based Monitoring Approaches

Monitoring ApproachTechnical RequirementsSensitivitySpecificityField ApplicabilityData Output
ImmunoassayModerateMediumHighExcellentPresence/Absence, Semi-quantitative
Aptamer BiosensorsHighVery HighVery HighGoodReal-time, Quantitative
Variant-Specific PCRModerateHighHighModerateGenotype Data, Quantitative
Environmental MetabarcodingHighVery HighMediumLimitedComprehensive, Community Context

These novel monitoring approaches could significantly enhance conservation efforts for this endangered species, which faces severe habitat reduction under future climate scenarios . By enabling non-invasive, regular monitoring, these techniques could provide early warning of population declines and facilitate rapid conservation interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.