Recombinant Capreolus capreolus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your reconstitution.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development for your product.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Capreolus capreolus (Roe deer)
Target Names
Target Protein Sequence
MPVLGSQRRLLGSLNCTPPATFPLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGALAARAAVVQQLDNVI DMLICGSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the regulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of MC1R in Capreolus capreolus compared to other mammalian species?

The MC1R protein in Capreolus capreolus, like in other mammals, plays a central role in regulating melanin synthesis and pigmentation patterns. As observed in comparative studies across mammalian lineages, MC1R functions within the Mc1r-Asip system to control the production of eumelanin (dark pigment) versus pheomelanin (yellow/red pigment) . In roe deer, this receptor would mediate responses to α-melanocyte stimulating hormone (αMSH), affecting seasonal coat color changes. Research methodology to study this would typically include:

  • Cloning and expressing the recombinant roe deer MC1R in heterologous expression systems

  • Comparing sequence homology with MC1R from phylogenetically related species

  • Testing functional responses to αMSH using cAMP accumulation assays

  • Correlating variants with coat color phenotypes observed in wild populations

How does the amino acid sequence of Capreolus capreolus MC1R differ from well-studied MC1R variants in other species?

While specific Capreolus capreolus MC1R sequence data is not comprehensively documented in the provided search results, comparative analysis with other species would likely reveal conservation in key functional domains. Research in other mammalian species has identified critical cysteine residues (particularly C35 on the N-terminus and C267, C273, and C289 on EC3) that are essential for maintaining receptor structure through disulfide bonds . The methodology to determine these differences includes:

  • Multiple sequence alignment of MC1R coding sequences across species

  • Identification of conserved domains versus species-specific variations

  • Structural modeling to predict functional consequences of amino acid substitutions

  • Targeted mutagenesis to confirm the role of specific residues

What expression systems are most effective for producing functional recombinant Capreolus capreolus MC1R?

For effective production of functional recombinant MC1R from roe deer, researchers should consider several expression systems based on the research needs:

  • Mammalian cell systems: HEK293 or CHO cells typically provide proper post-translational modifications and membrane insertion of G-protein coupled receptors

  • Insect cell systems: Sf9 or High Five cells using baculovirus vectors can yield higher protein amounts

  • Yeast systems: Pichia pastoris may be suitable for large-scale production with proper folding

The expression system should be selected based on the research question, with mammalian systems generally preferred for functional studies and insect or yeast systems for structural characterization when higher yields are required.

How can researchers effectively characterize the binding properties of recombinant Capreolus capreolus MC1R with αMSH?

To characterize binding properties between recombinant roe deer MC1R and αMSH, researchers should implement a multi-faceted approach:

  • Radioligand binding assays: Using radiolabeled αMSH to determine binding affinity (Kd) and receptor density

  • Surface plasmon resonance (SPR): For real-time kinetic analysis of association and dissociation rates

  • Fluorescence-based assays: FRET or fluorescence polarization to study binding dynamics

  • Functional coupling assays: Measuring cAMP accumulation following ligand binding to assess receptor activation

The resulting data should be analyzed using appropriate binding models (e.g., one-site binding, two-site binding) to determine binding parameters and compare them with MC1R from other species.

What techniques are most reliable for investigating the potential in-frame deletions in Capreolus capreolus MC1R?

Based on findings in other species like martens, which exhibit in-frame deletions in the MC1R coding region near TM2 and EC1 , researchers investigating potential similar features in roe deer MC1R should employ:

  • PCR-based methods: Designed to detect potential length polymorphisms

  • Sanger sequencing: To confirm exact deletion breakpoints

  • Long-read sequencing technologies: For comprehensive characterization of complex structural variants

  • Comparative genomic analysis: To identify evolutionary patterns of deletion events across related species

Researchers should pay particular attention to regions containing nucleotide motifs such as tandem repeats or inverted repeat-like segments that might facilitate deletion events, as observed in other species .

How can researchers assess the evolutionary constraints on Capreolus capreolus MC1R compared to other cervids?

To evaluate evolutionary constraints on roe deer MC1R, researchers should employ:

  • dN/dS ratio analysis: Calculate the ratio of nonsynonymous substitutions per nonsynonymous site (dN) to synonymous substitutions per synonymous site (dS) across cervid lineages

  • Bayesian selection analysis: To identify specific codons under positive or purifying selection

  • Phylogenetic comparative methods: To correlate MC1R sequence evolution with ecological factors and coat color adaptations

  • Analysis of conserved functional domains: To determine whether constraints vary across different regions of the protein

These approaches can reveal whether the roe deer MC1R has undergone adaptive evolution (dN/dS > 1), as seen in certain lineages like lion tamarin (dN/dS = 0.91) or mice adapting to grassland habitats, or whether it has been subject to strong purifying selection.

What is the significance of MC1R variants in seasonal coat color changes in Capreolus capreolus?

Investigating the role of MC1R variants in seasonal coat color changes in roe deer would require:

  • Seasonal sampling: Collection of tissue samples across different seasons to analyze MC1R expression patterns

  • Genotype-phenotype association studies: Correlating specific MC1R variants with observed coat color changes

  • Functional testing of variants: Using in vitro systems to assess how variants affect receptor function and response to hormonal changes

  • Comparative analysis: With other deer species showing seasonal coat color variations

This research would be particularly valuable given findings in other species like the Japanese Hokkaido sable (Martes zibellina brachyura), where coat color variations ranging from dark brown to bright yellow are associated with MC1R mutations, particularly the Cys35Phe mutation that disrupts critical disulfide bonds .

What CRISPR-based approaches are most effective for studying Capreolus capreolus MC1R function in cell models?

For CRISPR-based investigations of roe deer MC1R function, researchers should consider:

  • CRISPR/Cas9 knock-in strategies: To introduce roe deer MC1R variants into model cell lines

  • Base editing approaches: For introducing specific point mutations corresponding to naturally occurring variants

  • CRISPRa/CRISPRi systems: To modulate expression levels of MC1R and interacting proteins

  • CRISPR screens: To identify genes that modify MC1R signaling in deer-derived cell lines

When designing gRNAs, researchers should account for species-specific sequence differences and validate editing efficiency using sequencing and functional assays measuring cAMP production following αMSH stimulation.

How can researchers effectively assess the non-pigmentary functions of Capreolus capreolus MC1R?

Based on evidence that MC1R has pleiotropic effects beyond pigmentation, including roles in immune response, analgesia, and embryonic development , researchers studying roe deer MC1R should:

  • Transcriptomic analysis: Compare gene expression profiles between tissues expressing different MC1R variants

  • Immunological assays: Measure inflammatory responses in cells expressing recombinant roe deer MC1R variants

  • Developmental studies: Investigate MC1R expression patterns during different embryonic stages

  • Pain sensitivity assays: In appropriate model systems with roe deer MC1R variants

This approach acknowledges findings that MC1R is expressed in many somatic tissues during embryonic and fetal development, particularly in musculoskeletal and nervous systems, with patterns conserved across species .

How should researchers interpret conflicting functional data from recombinant Capreolus capreolus MC1R studies?

When facing conflicting data from MC1R functional studies, researchers should:

  • Compare experimental conditions: Analyze differences in expression systems, cell types, and assay conditions

  • Evaluate protein modifications: Assess variations in post-translational modifications and how they affect function

  • Consider receptor coupling efficiency: Analyze G-protein coupling differences between experimental systems

  • Implement statistical meta-analysis: When multiple datasets are available

This approach is informed by studies of human MC1R variants, where functional effects may vary between experimental systems, with consensus emerging only after multiple independent evaluations .

What statistical approaches are most appropriate for correlating MC1R variants with coat color phenotypes in wild Capreolus capreolus populations?

For robust statistical analysis of MC1R variant-phenotype correlations in wild populations:

  • Mixed-effects models: To account for environmental factors and genetic background

  • Bayesian inference approaches: Particularly useful with limited sample sizes from wild populations

  • Machine learning classification methods: To identify complex patterns of genotype-phenotype associations

  • Spatial statistical analysis: To incorporate geographic distribution and environmental gradients

These approaches should account for population structure and potential epistatic interactions with other genes in the pigmentation pathway, such as Agouti signaling protein (ASIP).

How do functional effects of Capreolus capreolus MC1R variants compare with well-characterized variants in other species?

Table 1: Comparative Functional Effects of MC1R Variants Across Species

SpeciesCommon VariantsFunctional EffectPhenotypic AssociationReference
HumanR151C, R160W, D294HSignificant loss of functionRed hair, fair skin
HumanV60L, V92M, R163QMild loss of functionWeak red hair association
Sable (M. zibellina)Cys35PheComplete loss of functionBright yellow coat
Mouse (M. musculus)Various lineage-specificVariable - adaptive evolution (dN/dS ≈ 1)Coat color adaptation to grasslands
Martens15bp, 18bp, 45bp deletionsStructural modificationsCoat color variation
Human carriers of CDKN2A mutationsV60L, V92M, R151C, R160WVariable loss of functionIncreased melanoma risk

For roe deer MC1R variants, researchers should perform similar functional characterization to determine where they fall on this spectrum and how they correlate with the species' characteristic coat coloration patterns.

What techniques can researchers use to determine if MC1R expression in non-cutaneous tissues of Capreolus capreolus follows patterns observed in other mammals?

To investigate non-cutaneous MC1R expression in roe deer:

  • RNA-seq analysis: To quantify MC1R expression across multiple tissue types

  • in situ hybridization: To precisely localize MC1R expression in tissue sections

  • RT-PCR: For targeted expression analysis in specific tissues

  • Immunohistochemistry: Using validated antibodies to detect MC1R protein

This multi-method approach is supported by findings that MC1R is widely expressed during embryonic and fetal development in humans, chicks, and mice, particularly in musculoskeletal and nervous systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.