Recombinant Capsella bursa-pastoris Apocytochrome f (petA) is a protein related to Capsella bursa-pastoris, also known as Shepherd's purse . C. bursa-pastoris is a common plant known for its medicinal properties and is found worldwide .
Apocytochrome f (petA) is a protein, and the recombinant form is produced using genetic engineering techniques . The petA gene encodes apocytochrome f, a subunit of the cytochrome $$b_6f$$ complex, which is essential for photosynthetic electron transfer in plants .
Key details:
Tag Information: The tag type is determined during the production process .
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .
Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended; store working aliquots at 4℃ for up to one week .
AA Sequence: The protein sequence includes specific amino acids, such as YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Recombinant Capsella bursa-pastoris Apocytochrome f (petA) is primarily used in Enzyme-Linked Immunosorbent Assays (ELISA) . ELISA is a biochemical technique used mainly in immunology to detect the presence of an antibody or an antigen in a sample .
Capsella bursa-pastoris has been used in traditional medicine for its anti-inflammatory and anti-superbacterial properties . Extracts from this plant have shown significant anti-inflammatory activity by reducing levels of nitric oxide (NO), cytokines (interleukin 1β [IL-1β], IL-6, and IL-10), and prostaglandin E2 (PGE2) . It is also known to contain the isothiocyanate compound sulforaphane .
Studies indicate that sulforaphane-containing solutions (SCS) isolated from Capsella bursa-pastoris exhibit anti-inflammatory and antibacterial effects . SCS can inhibit vancomycin-resistant enterococci (VRE) and Bacillus anthracis .
| Bacteria | MIC (µg/ml) |
|---|---|
| Vancomycin-resistant enterococci | 250 |
| Bacillus anthracis | 1,000 |
MIC = minimum inhibitory concentration.
Capsella bursa-pastoris is a recent allotetraploid, making it a valuable model for studying early changes following polyploidization . Genomic analysis has revealed that the species has two subgenomes, one descended from Capsella grandiflora and the other from Capsella orientalis . These subgenomes show different patterns of evolution and adaptation .
Capsella bursa-pastoris Apocytochrome f is a protein encoded by the petA gene found in Shepherd's purse (Thlaspi bursa-pastoris), a common flowering plant. The protein functions as Cytochrome f, a critical component of the electron transport chain in photosynthesis. The recombinant form consists of amino acids 36-320 of the mature protein and is typically produced with an N-terminal His tag to facilitate purification . The full amino acid sequence is:
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
This protein is typically studied in the context of photosynthetic electron transport research and comparative studies of photosynthetic machinery across different plant species.
E. coli remains the predominant expression system for recombinant Capsella bursa-pastoris Apocytochrome f due to its efficiency, cost-effectiveness, and high yield. When expressing this protein, researchers should consider the following methodological approaches:
Vector selection: pET vectors with T7 promoters offer tight control and high expression levels suitable for this protein.
E. coli strain optimization: BL21(DE3) or Rosetta strains are recommended, particularly when codon usage becomes a limiting factor for expression.
Induction parameters: IPTG concentration should be optimized (typically 0.1-1.0 mM) with induction at mid-log phase (OD600 of 0.6-0.8) for 4-6 hours at 30°C rather than 37°C to enhance proper folding.
Solubility enhancement: Co-expression with molecular chaperones or the addition of mild detergents during cell lysis can improve solubility of the membrane-associated regions.
The recombinant protein is typically produced with an N-terminal His tag to facilitate purification, though other affinity tags (such as GST or MBP) may be used depending on downstream applications .
Purification of Recombinant Capsella bursa-pastoris Apocytochrome f requires a methodical approach to maintain structural integrity while achieving >90% purity. A recommended protocol includes:
Cell lysis: Sonication or high-pressure homogenization in Tris/PBS-based buffer (pH 8.0) containing protease inhibitors and potentially mild detergents to solubilize membrane-associated portions.
Immobilized metal affinity chromatography (IMAC): Using Ni-NTA resin with stepwise imidazole elution (starting with 20-50 mM wash and eluting with 250-300 mM imidazole).
Buffer exchange: Dialysis against Tris/PBS-based buffer (pH 8.0) to remove imidazole.
Secondary purification: Size exclusion chromatography to remove aggregates and enhance purity beyond 90%.
Quality control: SDS-PAGE analysis to confirm purity, followed by Western blotting to verify identity.
The final product should be formulated in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability . For specialized applications, additional purification steps such as ion exchange chromatography may be necessary to achieve ultra-high purity.
Proper storage of Recombinant Capsella bursa-pastoris Apocytochrome f is crucial for maintaining structural integrity and functional activity. The methodological approach to storage should include:
Short-term storage (up to one week): Aliquot the purified protein and store at 4°C in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .
Long-term storage: Store the protein at -20°C or preferably -80°C with 50% glycerol as a cryoprotectant. The lyophilized form offers maximum stability for extended periods .
Reconstitution protocol: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 5-50% and aliquot for long-term storage at -20°C/-80°C .
Stability monitoring: Regularly check protein activity using functional assays specific to cytochrome f to ensure the storage conditions are maintaining protein integrity.
Thawing procedure: Rapid thawing at room temperature followed by immediate transfer to ice is recommended to prevent protein degradation. Repeated freeze-thaw cycles should be strictly avoided as they significantly decrease protein stability and activity .
Structural characterization of Recombinant Capsella bursa-pastoris Apocytochrome f requires a multi-technique approach to address its membrane-associated nature:
Circular Dichroism (CD) Spectroscopy: Optimal for secondary structure determination using far-UV spectra (190-250 nm) in a buffer with minimal interference (10 mM sodium phosphate, pH 7.4). Analysis should focus on alpha-helical content, which typically dominates the structure of cytochrome f proteins.
X-ray Crystallography Protocol:
Protein concentration: 5-10 mg/mL in a detergent-stabilized form
Initial screening: Commercial membrane protein screens (MemGold, MemStart)
Optimization: Vapor diffusion method with PEG 400-4000 as precipitant
Data collection: Synchrotron radiation sources recommended for optimal resolution
Cryo-EM Analysis: For proteins resistant to crystallization, single-particle cryo-EM offers an alternative approach:
Sample preparation: Protein at 1-3 mg/mL on glow-discharged grids
Vitrification parameters: Blotting time of 3-5 seconds before plunging into liquid ethane
Image processing: Use of motion correction and CTF estimation algorithms specific for membrane proteins
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Methodology: Expose protein to D2O buffer for varying time intervals (10 sec to 4 hours)
Analysis: Determine regions of high/low solvent accessibility to map transmembrane domains
Data interpretation: Use relative deuterium uptake to identify structured vs. flexible regions
These combined approaches provide complementary structural information, enabling a comprehensive understanding of the protein's three-dimensional architecture and membrane topology.
Functional characterization of Recombinant Capsella bursa-pastoris Apocytochrome f requires specialized assays to assess electron transport capabilities:
Spectroscopic Redox Assays:
Methodology: Monitor absorbance changes at 552 nm (reduced) vs. 540 nm (oxidized)
Protocol: Use artificial electron donors (ascorbate) and acceptors (potassium ferricyanide)
Data analysis: Calculate electron transfer rates using pseudo-first-order kinetics
Reconstitution in Liposomes:
Lipid composition: DOPC:DOPE:CL (70:20:10) to mimic thylakoid membrane
Protein:lipid ratio: Optimize between 1:100 to 1:500 (w/w)
Validation: Assess orientation using protease protection assays to ensure proper topology
In vitro Electron Transport Chain Reconstruction:
Component preparation: Purify interaction partners (plastocyanin, cytochrome b6)
Assembly protocol: Sequential addition of components in buffer containing 50 mM HEPES (pH 7.5), 100 mM NaCl, 5 mM MgCl2
Activity measurement: Oxygen consumption rates or fluorescent redox sensors
Electrochemical Measurements:
Electrode preparation: Gold electrodes modified with self-assembled monolayers
Protein immobilization: Site-specific coupling via engineered cysteine residues
Data acquisition: Cyclic voltammetry scanning from -400 to +400 mV vs. Ag/AgCl
These methodologies provide quantitative assessment of electron transfer kinetics and can be used to compare wild-type vs. mutant variants or to evaluate the effects of environmental factors on protein function.
Understanding protein-lipid interactions is crucial for characterizing Recombinant Capsella bursa-pastoris Apocytochrome f function, as it naturally resides in the thylakoid membrane. Several methodological approaches can be employed:
Fluorescence-based Lipid Binding Assays:
Methodology: Label protein with environment-sensitive fluorophores (e.g., NBD, BADAN) at specific sites
Titration protocol: Add increasing concentrations of liposomes (0.1-1000 μM) to labeled protein (0.1-1 μM)
Analysis: Monitor changes in fluorescence intensity, anisotropy, or lifetime
Surface Plasmon Resonance (SPR):
Surface preparation: Immobilize lipid bilayers on L1 sensor chip
Experimental design: Flow protein solutions (1-500 nM) over lipid surfaces
Data interpretation: Use two-state binding model to determine association/dissociation kinetics
Molecular Dynamics Simulations:
System setup: Embed protein structure in a bilayer composed of DGDG, MGDG, PG, and SQDG lipids
Simulation parameters: Run all-atom simulations for >100 ns with CHARMM36 force field
Analysis: Calculate lipid residence times, headgroup interactions, and membrane deformation
Nanodiscs Reconstitution:
Components: MSP1D1 scaffold protein and target lipid mixture
Assembly protocol: Detergent removal via Bio-Beads over 4 hours at 4°C
Validation: SEC-MALS to confirm homogeneous particle size distribution
These approaches reveal how specific lipids modulate protein structure and function, particularly important for understanding how the lipid environment influences electron transport efficiency in different membrane compositions .
Comparative analysis of Apocytochrome f (PetA) across plant species reveals important evolutionary and functional insights:
Sequence Homology Analysis Protocol:
Multiple sequence alignment: Using MUSCLE algorithm with gap opening penalty of -2.9 and gap extension penalty of 0
Conservation scoring: ConSurf method to identify functionally important residues
Comparative results: Key residues in the hydrophilic pocket show >90% conservation across land plants
Structural Comparison Methodology:
Homology modeling: Generate models using AlphaFold2 for species lacking experimental structures
Structural alignment: Calculate RMSD using PyMOL's align algorithm
Critical features: Focus on re-entrant helices and the hydrophilic pocket architecture
Findings: The hydrophilic pocket that facilitates PE transport shows structural conservation despite sequence variations
Functional Conservation Experimental Design:
Complementation assays: Express PetA homologs from different species in ΔpetA B. subtilis
Duramycin sensitivity testing: Compare restoration of function across homologs
Results: PetA proteins from various species including T. halophilus successfully complement B. subtilis ΔpetA mutants, suggesting functional conservation
Species-Specific Adaptations:
Environmental correlation: Compare PetA sequences from plants adapted to different habitats
Mutational analysis: Focus on non-conserved residues flanking the hydrophilic pocket
Findings: Species from drought-prone environments show adaptations that potentially enhance stability under water stress
This comparative approach provides valuable insights into the evolution of membrane protein function across plant lineages and identifies conserved structural elements essential for PE transport activity.
Site-directed mutagenesis studies on Recombinant Capsella bursa-pastoris Apocytochrome f and its homologs have revealed critical structure-function relationships:
Mutagenesis Design Strategy:
Target selection: Focus on conserved residues that line the hydrophilic pocket
Mutation types: Conservative (D→E, K→R) and non-conservative (D→A, K→A) substitutions
Controls: Surface-exposed non-conserved residues as negative controls
Expression and Purification Protocol:
Vector: pET28a with N-terminal His-tag
Expression conditions: BL21(DE3) E. coli, 0.5 mM IPTG induction at 30°C for 6 hours
Purification: Ni-NTA affinity chromatography followed by size exclusion
Functional Characterization Methods:
Key Findings from Mutagenesis Studies:
Conserved hydrophilic pocket residues: Mutations significantly impair the ability to confer duramycin sensitivity
Expression levels: Mutant proteins are produced at comparable levels to wild-type, confirming that functional defects are not due to expression differences
Structure-function correlation: The hydrophilic pocket is essential for PE transport, potentially binding the zwitterionic headgroup while allowing lipid tails to remain in the bilayer
This systematic mutagenesis approach has provided evidence that PetA functions as a transporter that catalyzes the movement of PE from the inner to the outer leaflet of the cytoplasmic membrane, similar to an elevator-type mechanism seen in small molecule transporters .
Protein aggregation is a common challenge when expressing Recombinant Capsella bursa-pastoris Apocytochrome f due to its membrane-associated domains. A methodological approach to troubleshooting includes:
Expression Temperature Optimization:
Protocol: Test expression at 37°C, 30°C, 25°C, and 18°C
Analysis: Compare soluble vs. insoluble fractions by SDS-PAGE
Finding: Lower temperatures (18-25°C) typically reduce aggregation by slowing folding kinetics
Detergent Screening Protocol:
Buffer composition: Base buffer (50 mM Tris, 150 mM NaCl, pH 8.0) plus test detergents
Detergent panel: Test mild non-ionic detergents (0.1% DDM, 0.5% CHAPS, 1% Triton X-100)
Analysis method: Measure protein recovery in supernatant after centrifugation at 100,000×g
Co-expression with Chaperones:
Plasmid systems: pG-KJE8 (dnaK-dnaJ-grpE + groES-groEL) or pTf16 (trigger factor)
Induction strategy: Pre-induce chaperones with 0.5 mg/ml L-arabinose or 5 ng/ml tetracycline 1 hour before target protein
Effectiveness measurement: Quantify soluble protein yield increase
Fusion Tag Optimization:
Construct design: Test N-terminal MBP, GST, or SUMO tags in addition to His-tag
Cleavage sites: Include TEV or PreScission protease sites for tag removal
Purification strategy: Two-step affinity chromatography with tag removal between steps
Implementing these methodological approaches can significantly increase the yield of properly folded, functional protein for downstream applications.
When working with Recombinant Capsella bursa-pastoris Apocytochrome f in PE transport assays, researchers may encounter low activity. The following troubleshooting approaches can help overcome these challenges:
Membrane Composition Optimization:
Lipid screening: Test different phospholipid compositions (varying PE:PC:PG ratios)
Protocol: Reconstitute protein in liposomes with systematically varied lipid compositions
Measurement: Compare transport rates using dura-FL fluorescent probes
Finding: Optimal activity typically requires lipid compositions that mimic the native membrane
Buffer Condition Refinement:
pH optimization: Test transport activity across pH range 6.0-8.5 in 0.5 unit increments
Salt concentration: Evaluate 50-300 mM NaCl to identify optimal ionic strength
Divalent cations: Assess the effect of 0-10 mM Mg²⁺ and Ca²⁺ on transport activity
Temperature dependence: Determine activity at 4°C, 25°C, 30°C, and 37°C
Protein Orientation Control:
Methodology: Implement symmetrical reconstitution vs. directional insertion
Validation: Use protease protection assays to determine protein orientation
Analysis: Compare PE transport rates in different orientations
Finding: Directed insertion can significantly enhance measurable activity by ensuring proper transmembrane topology
Coupling with Energetic Systems:
ATP regeneration system: Include 2 mM ATP, 5 mM phosphoenolpyruvate, and 10 U/mL pyruvate kinase
Proton gradient: Establish ΔpH using valinomycin/nigericin
Measurement: Monitor transport rates under different energetic conditions
Analysis: Determine if transport is enhanced by energetic coupling
By systematically addressing these factors, researchers can optimize assay conditions to achieve more robust and reproducible measurements of PE transport activity, facilitating more accurate structure-function analyses .
Recombinant Capsella bursa-pastoris Apocytochrome f offers unique opportunities for advancing membrane biophysics research:
Membrane Asymmetry Studies:
Experimental design: Reconstitute PetA in giant unilamellar vesicles (GUVs)
Measurement technique: Use dura-FL to quantify PE distribution between leaflets
Analysis: Calculate asymmetry index as ratio of outer:inner leaflet PE
Application: Model system for studying mechanisms maintaining membrane asymmetry
Lipid Flip-Flop Kinetics:
Methodology: Temperature-jump experiments with fluorescent PE analogs
Data collection: Time-resolved fluorescence measurements after rapid temperature shift
Analysis: Fit data to first-order kinetic models to extract rate constants
Finding: PetA increases the rate at which newly synthesized PE is distributed to the outer leaflet
Membrane Protein-Lipid Interactions:
Technique: Hydrogen-deuterium exchange mass spectrometry (HDX-MS)
Protocol: Expose protein-lipid complexes to D2O for varying time periods
Data analysis: Identify regions with altered exchange rates in presence of specific lipids
Application: Map lipid binding sites and conformational changes induced by lipid binding
Artificial Membrane Systems:
Construction method: PetA incorporation into droplet interface bilayers (DIBs)
Measurement: Single-channel electrical recordings
Analysis: Characterize conductance properties and gating behavior
Application: Designer membranes with controlled asymmetry for biotechnology applications
These approaches leverage PetA's natural function as a PE transporter to develop model systems for studying fundamental aspects of membrane biophysics, particularly the establishment and maintenance of lipid asymmetry .
Evolutionary analysis of the petA gene across plant species provides valuable insights into photosynthetic adaptation and membrane protein evolution:
Sequence-Based Phylogenetic Analysis:
Data collection: Extract petA sequences from 100+ plant species spanning major taxonomic groups
Alignment method: MAFFT with G-INS-i strategy for accurate alignment of conserved domains
Tree construction: Maximum likelihood using RAxML with PROTGAMMAAUTO model
Visualization: iTOL with domain architecture mapped to branches
Finding: Core functional domains show high conservation while terminal regions display lineage-specific adaptations
Selection Pressure Analysis:
Methodology: Calculate dN/dS ratios using PAML's branch-site models
Site-specific selection: Identify residues under positive selection using Bayes Empirical Bayes approach
Results interpretation: Map selected sites onto structural models
Finding: Transmembrane regions show strong purifying selection while surface-exposed loops exhibit greater variation
Synteny and Gene Context Analysis:
Data sources: Chloroplast genome assemblies from diverse plant lineages
Tools: MCscan for identifying syntenic blocks containing petA
Visualization: Circos plots showing conservation of gene order
Finding: petA genomic context is highly conserved in land plants with few exceptions
Correlation with Ecological Adaptation:
Approach: Compare petA sequences from plants adapted to different light environments
Analysis: Multivariate association between sequence features and habitat parameters
Statistical testing: Phylogenetic independent contrasts to account for shared ancestry
Finding: Specific amino acid substitutions correlate with adaptation to high-light environments
This evolutionary analysis provides context for understanding functional conservation and adaptation of PetA proteins across plant species, with implications for both basic research and applied aspects of photosynthesis engineering.