Recombinant Capsella bursa-pastoris ATP synthase subunit a, chloroplastic (atpI)

What is ATP synthase subunit a, chloroplastic (atpI) in Capsella bursa-pastoris?

ATP synthase subunit a (atpI) in Capsella bursa-pastoris is a critical component of the chloroplastic ATP synthase complex, specifically located in the F0 sector that spans the thylakoid membrane. According to product information, it's a 249-amino acid protein with the sequence "MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKIIQLPQGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH" . This protein plays a crucial role in the rotary mechanism of ATP synthesis during photosynthesis by facilitating proton movement across the membrane. The protein contains multiple transmembrane domains consistent with its role in forming the proton channel.

How does atpI differ functionally from ATP synthase subunit b (atpF)?

While both are components of the chloroplastic ATP synthase complex, atpI and atpF serve distinct functions. ATP synthase subunit a (atpI) forms the primary proton channel through which H+ ions flow during ATP synthesis, with its highly hydrophobic structure creating a path across the thylakoid membrane . In contrast, subunit b (atpF) acts as a peripheral stalk, connecting the membrane-embedded F0 sector to the catalytic F1 sector. The amino acid sequence of atpF ("MKNLTDSFVYLGHWPSAGSFGFNTDILATNPINLSVVFGVLVFFGKGVLNDLLDNRKQRILNTIRNSEELREGAIQQLENARARLRKVETEADKFRVNGYSEIEREQLNLINSTYKTLKQLENYKNETILFEQQRTINQVRERVFQQALQGAIGTLNSCLSNELHLRTINANIGMFGTMKEITD") reveals a more hydrophilic composition consistent with its structural support role .

What is the role of atpI in photosynthesis and energy metabolism?

ATP synthase subunit a (atpI) plays a crucial role in the energy transduction process of photosynthesis. During photosynthesis, light energy drives electron transport along the thylakoid membrane, creating a proton gradient. The proton flow through the channel formed partly by subunit a drives the rotation of the ATP synthase complex, coupling the proton motive force to ATP synthesis. This process is fundamental to cellular energy homeostasis in plants, as the ATP produced powers various metabolic processes. The specific sequence characteristics of Capsella bursa-pastoris atpI, with its transmembrane regions and conserved functional domains, are optimized for efficient proton translocation in this species' chloroplasts .

What are the optimal storage and handling conditions for recombinant Capsella bursa-pastoris atpI?

For optimal results when working with recombinant Capsella bursa-pastoris atpI, researchers should store the protein in Tris-based buffer with 50% glycerol at -20°C for regular storage and at -80°C for extended storage periods . To maintain protein integrity, create small aliquots to avoid repeated freeze-thaw cycles, as these can significantly damage protein structure and function. Working aliquots can be maintained at 4°C for up to one week . When handling the protein, maintain cold chain conditions and use sterile technique. Thaw frozen samples gently on ice when needed for experiments. For specific research applications, buffer conditions may need optimization regarding pH, ionic strength, and stabilizing agents based on the experimental design.

What techniques are available for studying protein-protein interactions involving atpI in chloroplasts?

Several sophisticated techniques can be employed to study protein-protein interactions involving atpI in chloroplasts:

• Co-immunoprecipitation (co-IP) coupled with label-free mass spectrometry is a powerful approach, as demonstrated with ATP synthase subunit α in other species . This involves using anti-atpI antibodies to pull down the protein complex from chloroplast extracts, followed by identification of interacting partners.

• Chemical cross-linking mass spectrometry (XL-MS) can identify specific interaction sites between atpI and other proteins.

• Bimolecular fluorescence complementation (BiFC) allows in vivo visualization of interactions.

• Surface plasmon resonance (SPR) provides quantitative analysis of binding kinetics.

When working with membrane proteins like atpI, careful optimization of detergent conditions is essential to maintain protein interactions while effectively solubilizing the thylakoid membrane environment.

How can I verify the structural integrity of purified recombinant atpI protein?

Verifying the structural integrity of purified recombinant atpI requires a multi-method approach. Initially, SDS-PAGE can confirm the correct molecular weight, while Western blotting with anti-atpI antibodies confirms identity . For secondary structure analysis, circular dichroism spectroscopy can verify the expected high alpha-helical content typical of ATP synthase subunit a. For tertiary structure, limited proteolysis followed by mass spectrometry can identify exposed regions versus protected domains. Since atpI is a membrane protein, detergent screening using techniques like size-exclusion chromatography helps determine proper folding in a membrane-mimicking environment. Functional integrity can be verified through reconstitution into liposomes and measuring proton translocation activity or ATP synthesis when combined with other ATP synthase subunits.

How can recombinant Capsella bursa-pastoris atpI be used in studies of chloroplast bioenergetics?

Recombinant Capsella bursa-pastoris atpI serves as a valuable tool in chloroplast bioenergetics research through multiple approaches:

• Reconstitution experiments: Incorporate purified atpI into liposomes with other ATP synthase subunits to create a minimal functional system for studying proton translocation and ATP synthesis.

• Site-directed mutagenesis: Modify specific residues to identify amino acids critical for proton channeling.

• Structural studies: Use the protein for cryo-electron microscopy to better understand its arrangement within the ATP synthase complex.

• Interaction studies: Apply techniques like co-immunoprecipitation coupled with mass spectrometry to identify binding partners .

• Quantitative proteomics: Use the recombinant protein as a standard in studies of chloroplast bioenergetics under various environmental conditions or developmental stages.

How does atpI contribute to stress responses in plants?

ATP synthase subunit a (atpI) plays a multifaceted role in plant stress responses, particularly through energy metabolism and oxidative stress management. During stress conditions, maintaining ATP production becomes crucial for powering stress response mechanisms. Research on ATP synthase interactomes has identified oxidative stress response proteins associated with ATP synthase complexes, including peroxiredoxins, catalase, and glutathione peroxidase . This suggests atpI participates in protein complexes that coordinate bioenergetics with redox homeostasis. The table below shows relative spectral matches of oxidative stress response proteins found in ATP synthase interactomes across different species:

While this data is from fish species, similar associations may exist in plant systems, suggesting potential protective mechanisms involving ATP synthase complexes during oxidative stress .

What is known about potential medicinal applications related to Capsella bursa-pastoris ATP synthase?

While specific medicinal applications of isolated atpI protein are not documented in the research literature, Capsella bursa-pastoris (Shepherd's purse) as a whole plant has demonstrated several pharmacological properties. Research has shown that Capsella bursa-pastoris ethanol extract (CBE) exhibits cholesterol-lowering effects by attenuating serum total and LDL cholesterol levels in obese mice . This effect is associated with decreased PCSK9 gene expression. Additionally, CBE protects against hepatic steatosis by inhibiting histone acetyltransferase activity . Water extract of Capsella bursa-pastoris also shows mitigating effects against doxorubicin-induced cardiotoxicity . The plant contains bioactive compounds including flavonoid glycosides such as apigenin-6,8-di-C-glucoside, isoorientin, isoquercitrin, and luteolin-7-O-glucoside . While these effects relate to whole-plant extracts rather than isolated atpI protein, they provide context for the biological significance of this species in medical research.

How do post-translational modifications affect the function of chloroplastic ATP synthase subunit a?

Post-translational modifications (PTMs) of chloroplastic ATP synthase subunit a can significantly impact its function through multiple mechanisms. Common PTMs in chloroplast proteins include phosphorylation, acetylation, and redox-based modifications. These modifications can alter protein conformation, affecting proton channel properties or interactions with other ATP synthase subunits. For instance, phosphorylation at key residues might modulate protein-protein interactions or change the efficiency of proton translocation. Redox modifications, particularly important in chloroplasts where redox changes occur during photosynthesis, might serve as regulatory switches in response to changing light conditions.

Methodologically, researchers can identify these modifications using:

• Phosphoproteomics with titanium dioxide enrichment for phosphopeptides

• Redox proteomics approaches like OxiCAT (oxidative cysteine-targeted affinity tags) to detect redox-sensitive cysteines

• Site-directed mutagenesis of potentially modified residues, combined with functional assays

What is known about the interactome of ATP synthase in Capsella bursa-pastoris compared to other species?

While the specific interactome of ATP synthase from Capsella bursa-pastoris hasn't been directly characterized in the available research, insights can be drawn from studies of ATP synthase interactomes in other species. Research on ATP synthase subunit α interactomes in notothenioid fish species revealed significant variations between species, with one species (C. gunnari) showing a significantly reduced interactome compared to others . The study found that oxidative stress response proteins including carbonyl reductase, catalase, glutathione peroxidase, and peroxiredoxins associate with ATP synthase complexes to varying degrees across species .

Based on this comparative data, we might expect the Capsella bursa-pastoris atpI interactome to include:

• Core ATP synthase components

• Chaperones involved in protein folding

• Antioxidant enzymes similar to those found in other species' interactomes

• Plant-specific interactions with thylakoid membrane proteins and photosynthesis-related components

How can computational approaches contribute to understanding atpI structure and function?

Computational approaches offer valuable insights into Capsella bursa-pastoris atpI structure and function through multiple strategies:

• Homology modeling using the amino acid sequence provided in product information can generate three-dimensional structural predictions that reveal the arrangement of transmembrane helices and potential proton-conducting residues .

• Molecular dynamics simulations can model how these structures behave in a lipid bilayer environment, potentially capturing conformational changes associated with proton translocation.

• Multiple sequence alignment across species helps pinpoint functionally critical residues through identification of conserved motifs.

• Docking simulations can predict interactions with other ATP synthase subunits, particularly the c-ring that rotates against subunit a during ATP synthesis.

• Quantum mechanical calculations can model proton movement through the predicted channel, offering insights into the energetics and mechanism of proton translocation that would be difficult to capture experimentally.

These computational predictions should be validated through experimental approaches such as site-directed mutagenesis of predicted key residues.

What are common challenges in expressing and purifying functional recombinant atpI?

Expressing and purifying functional recombinant atpI presents several challenges due to its nature as a membrane protein with multiple transmembrane domains. Key challenges and methodological solutions include:

• Protein misfolding and aggregation: Optimize expression using specialized E. coli strains designed for membrane proteins, lower induction temperatures (16-18°C), and weaker promoters to slow expression.

• Detergent selection: The choice of detergent is crucial—harsh detergents efficiently extract the protein but may denature it, while milder ones better preserve native structure. A systematic detergent screening approach is recommended.

• Low expression yields: Optimize codon usage for the expression host and consider fusion tags that can enhance solubility.

• Refolding challenges: Develop strategies such as gradual detergent exchange or reconstitution into nanodiscs or liposomes to recover function after purification.

• Functionality verification: Since atpI alone doesn't exhibit easily measurable enzymatic activity, reconstitution with other ATP synthase subunits may be necessary for functional assays.

How can I differentiate between native and denatured conformations of recombinant atpI?

Differentiating between native and denatured conformations of recombinant atpI requires a combination of biophysical and functional approaches:

• Circular dichroism (CD) spectroscopy: Native atpI shows characteristic α-helical patterns versus random coil signals in denatured samples.

• Size-exclusion chromatography: Distinguishes properly folded monomeric protein from aggregates.

• Intrinsic tryptophan fluorescence spectroscopy: Reveals changes in the local environment of tryptophan residues, which typically shift to longer wavelengths upon denaturation.

• Detergent resistance assays: Native membrane proteins typically remain soluble in mild detergents while denatured forms aggregate.

• Reconstitution assays: Only properly folded atpI would contribute to functional proton channel formation in liposome reconstitution experiments.

• Limited proteolysis: Native conformations often show distinct, protected fragments compared to the more random digestion pattern of denatured protein.

These complementary methods provide a comprehensive assessment of protein conformational state.

What controls should be included when studying atpI function in reconstituted systems?

When studying atpI function in reconstituted systems, several essential controls must be included to ensure valid interpretations:

• Liposome-only controls (without protein) to establish baseline proton permeability or leakage.

• Heat-denatured atpI sample as a negative control, confirming that observed activity requires properly folded protein.

• Inhibitor controls: Reconstitution with known proton channel inhibitors (such as DCCD for ATP synthase) should abolish activity if the system is functioning as expected.

• Subunit-specific controls: When studying atpI as part of the complete ATP synthase complex, include reconstitution with individual subunits or subcomplexes to determine specific contributions.

• Orientation controls: Use techniques like protease protection assays or oriented reconstitution to verify the correct insertion direction of atpI in liposomes.

• Concentration gradient controls: Vary protein-to-lipid ratios to identify optimal reconstitution conditions and potential concentration-dependent effects.

For ATP synthesis measurements, include experiments without proton gradient or with uncouplers like FCCP to confirm that ATP production is driven by the proton motive force.