Recombinant Capsella bursa-pastoris Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Overview of CemA

CemA refers to the Chloroplast Envelope Membrane protein found in Capsella bursa-pastoris, also known as Shepherd's Purse, which belongs to the Brassicaceae family. Research on chloroplasts and their envelope membranes is vital to understanding plant cell metabolism and the development of freezing tolerance .

Identification and Function

Proteomic analyses are used to identify proteins located in the chloroplast envelope . These proteins are involved in various functions:

  • Ion and metabolite transport

  • Components of the protein import machinery

  • Chloroplast lipid metabolism

Proteomic Studies of Chloroplast Envelope Membranes

Proteomics is used to analyze the protein composition of chloroplast envelope membranes . Subcellular and subplastidial proteomics, in combination with prior enrichment of subplastidial compartments, has helped to decipher the basic membrane protein composition of the envelope proteomes of Arabidopsis thaliana and a few other plants .

To identify specific envelope proteins with increasing accuracy and clarify the subcellular or subplastidial localization of identified proteins, mass spectrometry (MS) is performed to compare purified envelope fractions and crude cell extracts .

Importance of Chloroplast Envelope Proteins in Cold Acclimation

Chloroplasts are important for cold acclimation and the acquisition of freezing tolerance in plants . During cold acclimation, the properties of the chloroplast change markedly . Spatial proteomics has enabled the identification of proteins differentially localized at the envelope membrane under changing environmental regimes .

Experimental Methods for Studying Chloroplast Envelope Proteins

To study chloroplast envelope proteins, researchers perform the following steps :

  1. Isolate chloroplasts from plant leaves.

  2. Lyse the chloroplasts in hypotonic medium containing protease inhibitors.

  3. Purify the envelope from the lysate by centrifugation on sucrose gradients.

  4. Recover the envelope proteins and subject them to further analysis, such as SDS-PAGE and Western blotting.

Tools and Databases for Chloroplast Envelope Proteome Analysis

Several proteome processing databases, such as MASCP Gator and SUBA, enhance the evaluation of chloroplast envelope proteome results . These databases, combined with improved mass spectrometry sensitivity, facilitate the identification of specific envelope proteins and the exclusion of contaminants from other plastid or cell compartments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEELFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) from Capsella bursa-pastoris?

The chloroplast envelope membrane protein (cemA) is a membrane-bound protein encoded in the chloroplast genome of Capsella bursa-pastoris (shepherd's purse). According to structural data, cemA from C. bursa-pastoris consists of 229 amino acids and is cataloged in UniProtKB with the identifier A4QKK4 . The protein is integrated into the chloroplast envelope membrane where it likely contributes to essential chloroplast functions. While the exact function remains under investigation, its conservation across plant species suggests important roles in chloroplast membrane processes, potentially linked to the plant's medicinal properties and adaptive capabilities.

How does Capsella bursa-pastoris cemA compare to cemA proteins from other species?

The cemA protein demonstrates notable differences between species, which may reflect evolutionary adaptations and functional specialization. As shown in Table 1, the cemA protein from Capsella bursa-pastoris (229 amino acids) is significantly shorter than its counterpart in Nephroselmis olivacea (392 amino acids) . This substantial length difference suggests potential structural and functional variations between these proteins across different photosynthetic organisms. While both proteins share the same general classification as chloroplast envelope membrane proteins, these differences may indicate species-specific adaptations related to environmental conditions or metabolic requirements.

Table 1: Comparison of cemA Protein Characteristics Between Species

CharacteristicCapsella bursa-pastoris cemANephroselmis olivacea cemA
Sequence Length229 amino acids392 amino acids
UniProt IDA4QKK4Q9TKZ2
Structure DeterminationComputed model (AlphaFold)Not specified
Model ConfidencepLDDT global: 79.49Not applicable
Expression SystemNot specifiedE. coli

What biological significance does Capsella bursa-pastoris hold as a research organism?

Capsella bursa-pastoris (shepherd's purse) has significant biological importance as a research organism for several reasons. It belongs to the Brassicaceae family and has been recently introduced to the European Pharmacopoeia as a medicinal plant . The plant contains numerous bioactive compounds including flavonoids, phenolic acids, amino acids, phytosterols, vitamins, and bioelements that contribute to its medicinal properties . Ethnobotanical research shows it has been traditionally used for digestive system support, antihemorrhagic applications, and treatment of various conditions . Native American tribes utilized it for treating dysentery, diarrhea, stomach pains, and as a food source . The plant also demonstrates phytoremediation properties and biotechnological applications for creating resistant crop varieties within the Brassicaceae family .

What expression systems are optimal for producing recombinant cemA protein?

The optimal expression system for recombinant cemA protein production depends on research objectives, required protein functionality, and downstream applications. Based on analogous proteins, several expression systems may be considered:

  • Bacterial expression (E. coli): The cemA protein from Nephroselmis olivacea has been successfully expressed in E. coli with an N-terminal His tag . This system offers advantages of rapid growth, high protein yields, and straightforward genetic manipulation.

  • Eukaryotic expression systems: For improved folding and post-translational modifications, yeast or insect cell systems might provide advantages over bacterial expression.

  • Homologous expression: Expression in plant systems may provide the most authentic protein folding and modifications, particularly important if studying interactions with other plant proteins.

For initial expression attempts, the E. coli system with affinity tags (His tag) appears effective based on analogous cemA proteins . Optimization should focus on codon usage, expression temperature, and induction conditions to maximize yield while maintaining proper folding.

What purification strategies are most effective for recombinant cemA protein?

Effective purification of recombinant cemA requires addressing the challenges associated with membrane proteins. Based on available data for similar proteins, a multi-step strategy is recommended:

  • Affinity chromatography: Using His-tagged constructs (as demonstrated with Nephroselmis olivacea cemA) enables initial purification via nickel or cobalt affinity columns .

  • Membrane protein solubilization: Appropriate detergents must be selected to extract cemA from membranes while maintaining native conformation.

  • Secondary purification: Size exclusion chromatography or ion exchange chromatography can improve purity after initial affinity purification.

  • Final preparation: As indicated for similar proteins, lyophilization in a protective buffer containing 6% trehalose at pH 8.0 can maintain stability . The purified protein should be assessed for purity using SDS-PAGE, aiming for >90% purity as achieved with similar recombinant proteins .

How can researchers assess the functional integrity of purified recombinant cemA protein?

Assessing functional integrity of purified cemA requires multiple complementary approaches:

  • Structural analysis: Circular dichroism spectroscopy to confirm secondary structure content and proper folding, comparing results to computational predictions (pLDDT score of 79.49) .

  • Membrane integration assays: Confirming the protein's ability to incorporate into artificial liposomes or isolated chloroplast membranes.

  • Interaction studies: Identifying whether the recombinant protein maintains expected protein-protein interactions with other chloroplast components.

  • Functional complementation: Testing whether the recombinant protein can restore function in cemA-deficient mutant plants or bacterial systems.

  • Stability assessment: Thermal shift assays to determine if the protein exhibits expected stability properties characteristic of membrane proteins.

These approaches collectively provide a comprehensive evaluation of whether the recombinant protein maintains native-like properties after expression and purification.

What are the optimal storage conditions for maintaining recombinant cemA stability?

Based on protocols established for similar proteins, the following storage conditions are recommended for maintaining recombinant cemA stability:

Table 2: Recommended Storage Conditions for Recombinant cemA Protein

ParameterRecommendationNotes
FormLyophilized powderFor long-term stability
ReconstitutionDeionized sterile waterTo 0.1-1.0 mg/mL concentration
Additives5-50% glycerolFor long-term storage
Storage Temperature-20°C/-80°CFor stock solution
Working Storage4°CFor up to one week
BufferTris/PBS-based, pH 8.0With 6% Trehalose
Special ConsiderationsAvoid repeated freeze-thaw cyclesAliquot before freezing

The addition of 6% trehalose in Tris/PBS-based buffer at pH 8.0 has been shown to enhance stability for similar proteins . Repeated freeze-thaw cycles should be strictly avoided, with working aliquots maintained at 4°C for no more than one week . For reconstitution of lyophilized protein, brief centrifugation prior to opening is recommended to ensure contents settle at the bottom of the vial .

What techniques can be used to study the interaction of cemA with other chloroplast proteins?

Investigating cemA interactions with other chloroplast proteins requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against cemA to pull down interacting proteins from chloroplast extracts, followed by mass spectrometry identification.

  • Pull-down assays: Immobilizing purified recombinant His-tagged cemA on affinity resin to capture interaction partners from chloroplast lysates.

  • Yeast two-hybrid (Y2H) screening: Testing specific candidate interactions or conducting library screens to identify potential interacting partners.

  • Bimolecular fluorescence complementation (BiFC): Visualizing protein interactions in vivo by fusing cemA and candidate partners to complementary fragments of a fluorescent protein.

  • Crosslinking mass spectrometry: Using chemical crosslinkers to capture transient interactions followed by MS identification of crosslinked peptides.

  • Blue native PAGE: Analyzing native protein complexes containing cemA to identify stable interaction partners and complex sizes.

These techniques together provide a comprehensive interaction landscape to better understand cemA's functional role within the chloroplast membrane system.

How can researchers investigate the potential role of cemA in the medicinal properties of Capsella bursa-pastoris?

Investigating cemA's potential contribution to C. bursa-pastoris medicinal properties requires a multidisciplinary approach:

  • Genetic modification: Creating cemA knockdown or knockout lines to assess changes in bioactive compound profiles, comparing with wild-type plants.

  • Metabolomic analysis: Conducting comparative metabolomic studies between wild-type and cemA-modified plants to identify differences in medicinally relevant compounds.

  • Bioactivity assays: Testing extracts from wild-type and cemA-modified plants for anti-inflammatory, antibacterial, antifungal, and anticholinesterase activities, which are documented properties of C. bursa-pastoris .

  • Pathway analysis: Investigating whether cemA influences biosynthetic pathways for key compounds like flavonoids, phenolic acids, or phytosterols that contribute to the plant's medicinal properties .

  • Stress response studies: Examining whether cemA impacts the plant's response to environmental stressors that might induce production of bioactive compounds.

This approach would help establish whether cemA plays a direct or indirect role in the production of compounds responsible for the documented anti-inflammatory, antioxidant, antibacterial, antifungal, acetylcholinesterase inhibitory, and anticancer properties of C. bursa-pastoris .

What approaches can be used to study the impact of environmental factors on cemA expression and function?

Environmental factors may significantly influence cemA expression and function in Capsella bursa-pastoris, potentially contributing to the plant's phenotypic plasticity and colonization success . To investigate these relationships, researchers can employ:

  • Transcriptomic analysis: Using RNA-seq or qRT-PCR to quantify cemA expression levels under various environmental conditions (temperature variations, drought, salinity, light intensity).

  • Proteomic studies: Employing western blot or mass spectrometry to measure cemA protein abundance across environmental gradients.

  • Population genomics: Comparing cemA sequence variations among C. bursa-pastoris populations from diverse habitats to identify potential adaptive mutations.

  • Chloroplast function assays: Measuring photosynthetic parameters and chloroplast membrane integrity under environmental stress conditions in wild-type versus cemA-modified plants.

  • Reporter gene constructs: Creating cemA promoter-reporter fusions to visualize expression patterns in response to environmental cues.

  • Comparative studies across ecotypes: Analyzing cemA expression and function in different ecotypes adapted to specific environmental conditions.

These approaches would help elucidate whether cemA plays a role in adaptation to different environments and contribute to understanding the broader context of how C. bursa-pastoris has succeeded as a colonizing species .

How might cemA research contribute to understanding plant adaptation mechanisms?

Research on cemA from Capsella bursa-pastoris offers valuable insights into plant adaptation mechanisms through several avenues:

  • Evolutionary comparisons: The significant size difference between cemA proteins from C. bursa-pastoris (229 amino acids) and Nephroselmis olivacea (392 amino acids) suggests evolutionary adaptation processes that may correlate with ecological niches .

  • Colonization biology: Understanding how cemA functions may help explain C. bursa-pastoris' success as a colonizing species, which depends on interplay between phenotypic plasticity, adaptive potential, and demographic history .

  • Stress response pathway: As a chloroplast membrane protein, cemA may participate in signaling pathways related to environmental stress responses, potentially contributing to the plant's ability to thrive in diverse environments.

  • Molecular adaptation: Studying sequence variations in cemA across populations may reveal molecular signatures of selection that contribute to local adaptation.

  • Functional plasticity: Investigating how cemA function varies across different environmental conditions may provide insights into the molecular basis of phenotypic plasticity in plants.

These research directions would contribute to our broader understanding of how chloroplast proteins contribute to plant adaptation and survival across environmental gradients.

What potential biotechnological applications might arise from cemA research?

Research on cemA from Capsella bursa-pastoris may lead to several biotechnological applications:

  • Improved crop resilience: Understanding how cemA contributes to environmental adaptation could inform strategies for enhancing stress tolerance in related Brassicaceae crop species .

  • Bioactive compound production: If cemA influences the production of medicinal compounds, this knowledge could be applied to optimize the production of these bioactive molecules in controlled cultivation or in heterologous expression systems.

  • Phytoremediation applications: C. bursa-pastoris has documented phytoremediation properties , and understanding cemA's potential role in this process could lead to enhanced bioremediation strategies.

  • Protein engineering: Structural insights from cemA could inform the design of modified chloroplast membrane proteins with enhanced or novel functions for synthetic biology applications.

  • Chloroplast biotechnology: Knowledge of cemA function could contribute to broader efforts in chloroplast engineering for improved photosynthetic efficiency or novel biosynthetic capabilities.

These applications align with the documented value of C. bursa-pastoris in biotechnology for creating resistant crop varieties within the Brassicaceae family .

Table 3: Key Research Methods for Investigating Recombinant cemA Protein

Research AspectKey MethodsExpected Outcomes
Structural CharacterizationX-ray crystallography, Cryo-EM, Validated computational modelsRefined structural model beyond computational prediction
Functional AnalysisComplementation studies, Membrane integration assays, Transport assaysUnderstanding of cemA's role in chloroplast function
Interaction StudiesCo-IP, Pull-down assays, Y2H, BiFC, Crosslinking MSMap of cemA's protein interaction network
Environmental ResponseTranscriptomics, Proteomics, Physiological assays under varied conditionsInsight into cemA's role in environmental adaptation
Medicinal ApplicationsMetabolomic analysis, Bioactivity assays, Pathway analysisConnection between cemA and bioactive compound production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.