Recombinant Capsella bursa-pastoris NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic

Shipped with Ice Packs
In Stock

Description

Biological Role in Chloroplasts

This subunit is part of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which facilitates electron transfer from NAD(P)H to plastoquinone (PQ), contributing to:

  • Cyclic Electron Flow (CEF): Maintains ATP/NADPH balance during photosynthesis by recycling electrons .

  • Chlororespiration: Protects photosystems under stress by dissipating excess reducing power .

  • Prenylquinone Metabolism: Regulates redox states of plastoquinone reservoirs in plastoglobules, impacting vitamin K1 and plastochromanol-8 biosynthesis .

In Arabidopsis, homologs like NDC1 (AT5G08740) reduce PQ in plastoglobules, stabilizing the PQ pool’s redox state and enabling stress adaptation .

3.1. Enzymatic Studies

The recombinant enzyme is used to study:

  • Substrate Specificity: Reduces quinones, nitroaromatics, and azo dyes via a two-electron transfer mechanism, avoiding reactive oxygen species (ROS) generation .

  • Protein Stability: NAD(P)H-dependent stabilization of regulators like p53 and PGC1α .

3.3. Agricultural Biotechnology

  • Stress Tolerance: Overexpression in crops could enhance resilience to oxidative stress by modulating PQ redox states .

Future Directions

  • Mechanistic Studies: Resolving crystal structures to elucidate electron transfer pathways .

  • Biotechnological Engineering: Optimizing expression systems (e.g., E. coli, yeast) for high-yield production .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are sent with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)
Target Names
ndhA
Target Protein Sequence
MIIYATAVQTINSFVKLESLKEVYGLIWIFVPIFFLVLGIITGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGIKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN HLILADLNIGIFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEEL IAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNFSIPYISILELFQRDQIFGT TIGIFITLAKTYLFLFISIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQLFSL
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinones in the photosynthetic chain and potentially a chloroplast respiratory chain. This process involves FMN and iron-sulfur (Fe-S) centers. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving the redox energy within a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase and how was it initially identified?

Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 1 (CbRCI35) belongs to the type III peroxidase family and was initially identified as a cold-responsive gene in plants. The enzyme catalyzes the transfer of electrons from NAD(P)H to quinones, playing a significant role in plant responses to abiotic stresses, particularly low temperatures. CbRCI35 has been reported as a cold-responsive gene that contributes to cold tolerance through regulation of reactive oxygen species (ROS) homeostasis . Similar to other quinone oxidoreductases, CbRCI35 possesses structural domains for binding NAD(P)H and specific substrates, functioning within a complex system of redox regulation that helps plants adapt to environmental challenges.

What distinguishes NAD(P)H-quinone oxidoreductase from other oxidoreductases in plants?

NAD(P)H-quinone oxidoreductases are distinguished by their ability to specifically catalyze the reduction of quinones using electrons from NAD(P)H. Unlike dehydrogenases that typically transfer electrons to other organic compounds, these enzymes have evolved specialized substrate-binding pockets that accommodate quinone structures . Structurally, they contain both NAD(P)H-binding grooves and substrate-binding pockets, allowing them to facilitate electron transfer between these molecules . The CbRCI35 enzyme from Capsella bursa-pastoris specifically demonstrates unique features, including a cold-responsive regulatory element in its promoter region that enables increased expression during temperature stress, distinguishing it from constitutively expressed oxidoreductases .

What cellular compartments contain active CbRCI35, and how does this localization relate to its function?

CbRCI35 is primarily localized in the cytoplasm according to sequence prediction and GFP fusion assay results . This cytoplasmic localization is strategic for the enzyme's function in ROS homeostasis, as it positions the enzyme to intercept and neutralize cytosolic ROS that accumulate during cold stress. The cytoplasmic compartmentalization places CbRCI35 in proximity to potential quinone substrates and NADPH, maximizing its catalytic efficiency. Despite being classified as "chloroplastic" in some annotations, experimental evidence confirms predominant cytoplasmic localization, suggesting that its interactions with chloroplast-generated ROS likely occur at the chloroplast-cytosol interface or through secondary messenger systems rather than direct action within the chloroplast .

What is the detailed molecular architecture of CbRCI35, and how does it facilitate electron transfer?

Though the specific crystal structure of CbRCI35 has not been fully elucidated in the provided research, insights can be drawn from homologous NAD(P)H-dependent quinone oxidoreductases like the one from Phytophthora capsici (PcQOR). These enzymes typically exhibit a bi-modular architecture with distinct NADPH-binding grooves and substrate-binding pockets in each subunit . The active site architecture positions the nicotinamide ring of NADPH in proximity to the quinone substrate, facilitating direct electron transfer. Critical amino acid residues, potentially similar to those identified in PcQOR (such as R45, Q48, Y54, C147, and T148), likely stabilize the substrate and influence its redox potential . From structural homology predictions, CbRCI35 probably functions as an oligomer (possibly a tetramer like PcQOR), which contributes to structural stability and potentially provides allosteric regulation mechanisms.

How do researchers determine substrate specificity for CbRCI35, and what are its preferred substrates?

Determining substrate specificity for CbRCI35 requires systematic enzymatic assays using various potential quinone substrates while monitoring NADPH oxidation spectrophotometrically at 340 nm. Based on studies of similar enzymes, researchers typically dissolve candidate substrates in absolute alcohol (maintaining a final 2% concentration in the assay) and measure reaction rates with purified enzyme at controlled temperatures (e.g., 25°C) . For CbRCI35, preferred substrates would likely include biologically relevant quinones involved in plant stress response pathways. Comparative kinetic analyses (determining kcat and Km values) for different substrates provide quantitative measures of specificity. Site-directed mutagenesis of predicted substrate-binding residues, followed by activity assays, helps identify amino acids critical for substrate recognition . Molecular docking simulations further elucidate potential binding modes and interaction energies with different quinones.

What cofactors are essential for CbRCI35 activity, and how do they influence reaction kinetics?

NADPH serves as the primary electron donor cofactor for CbRCI35 activity, providing the reducing power necessary for quinone reduction . The enzyme's active site architecture positions the nicotinamide moiety of NADPH in optimal orientation for electron transfer to bound quinone substrates. Reaction kinetics are influenced by NADPH binding affinity, which can be altered by amino acid residues in the NADPH-binding groove. Potential metal ions may also serve as secondary cofactors, influencing either structural stability or directly participating in the catalytic mechanism. Unlike some related alcohol dehydrogenases, quinone oxidoreductases like CbRCI35 typically lack zinc-binding motifs, which affects their substrate specificity and reaction mechanisms . The redox state of the cellular environment also significantly impacts the reaction kinetics by affecting the availability of reduced NADPH and the recycling rate of the enzyme.

What transcriptional elements control CbRCI35 expression, and how do they respond to environmental stimuli?

The promoter region of CbRCI35 contains specific regulatory elements that respond to cold temperature stimuli, classifying it as a cold-responsive gene . Analysis of its promoter activity using the GUS reporter system has revealed that CbRCI35 transcription increases significantly upon exposure to low temperatures. The promoter likely contains cis-elements that interact with cold-responsive transcription factors, potentially including C-repeat binding factors (CBFs) or inducer of CBF expression (ICE) transcription factors that are central to plant cold-response pathways. Beyond cold-response elements, the promoter may also contain motifs responsive to other stresses that generate reactive oxygen species, creating an integrated regulatory network. Bioinformatic analysis of the promoter sequence could reveal additional regulatory elements potentially responsive to other environmental cues, including drought, salinity, or pathogen exposure, suggesting a broader role in general stress responses beyond cold tolerance .

What signaling cascades mediate cold-induced upregulation of CbRCI35?

Cold-induced upregulation of CbRCI35 likely involves multiple interconnected signaling cascades. Initial cold perception occurs at the plasma membrane, potentially through changes in membrane fluidity that activate calcium channels. The resulting calcium influx triggers calcium-dependent protein kinases (CDPKs) and mitogen-activated protein kinase (MAPK) cascades. These kinases phosphorylate transcription factors such as ICE1 (Inducer of CBF Expression 1), activating them to bind to promoter elements of cold-responsive genes like CbRCI35 . Concurrently, cold stress increases ROS production, activating redox-sensitive transcription factors that may also regulate CbRCI35 expression. Transgenic studies have shown that overexpression of CbRCI35 enhances cold tolerance and alters the expression of downstream cold-responsive genes, suggesting it may participate in positive feedback loops that amplify cold-response signaling . Hormonal signaling involving abscisic acid likely intersects with these pathways, creating a complex regulatory network that fine-tunes CbRCI35 expression according to stress severity and duration.

How does post-translational modification affect CbRCI35 activity during stress responses?

While the search results don't explicitly detail post-translational modifications (PTMs) of CbRCI35, its function in stress response suggests probable regulation through various PTMs. Phosphorylation by stress-activated kinases likely modulates enzyme activity, altering substrate binding affinity or catalytic efficiency in response to changing cellular conditions. Redox-based modifications such as oxidation/reduction of critical cysteine residues may function as molecular switches controlling enzyme activity, particularly relevant given the protein's role in ROS homeostasis. Cold stress induces membrane rigidification and cytoskeletal rearrangements that could affect CbRCI35 compartmentalization and its access to substrates, representing a form of spatial regulation. Changes in cellular pH during stress responses may also alter the protein's conformation and activity. Studies with similar enzymes suggest that protein-protein interactions with stress-induced chaperones might stabilize CbRCI35 structure under cold conditions, maintaining its functionality when most cellular processes slow down .

What are the optimal protocols for heterologous expression and purification of functional CbRCI35?

For optimal heterologous expression of functional CbRCI35, researchers should consider several key factors. Expression in E. coli BL21(DE3) using pET vectors is recommended, with the coding sequence optimized for E. coli codon usage and inclusion of an N-terminal His-tag for purification. Induction with 0.1-0.5 mM IPTG at lower temperatures (16-18°C) for 16-20 hours enhances soluble protein yield by reducing inclusion body formation. For purification, a multi-step approach is effective: initial capture on Ni-NTA affinity columns (using 20 mM imidazole in wash buffers and 250 mM for elution), followed by size-exclusion chromatography to ensure oligomeric homogeneity . Buffer optimization is critical—include 10% glycerol, 1-5 mM DTT or β-mercaptoethanol to maintain reducing conditions, and consider adding 100 μM NADPH to stabilize the enzyme's active site. For activity studies, recombinant protein should be stored at -80°C in small aliquots with 20% glycerol to prevent freeze-thaw cycles. Verification of proper folding through circular dichroism spectroscopy and activity assays with model substrates ensures functional quality of the purified enzyme .

What are the most reliable methods for measuring CbRCI35 enzymatic activity?

The most reliable method for measuring CbRCI35 enzymatic activity involves spectrophotometric monitoring of NADPH oxidation at 340 nm, which directly corresponds to the rate of quinone reduction. Reaction mixtures typically contain purified enzyme (0.05-0.1 μM), NADPH (0.2 mM), and quinone substrates (0.25 mM) dissolved in absolute alcohol (final concentration 2%) in appropriate buffer systems maintained at controlled temperatures (25°C) . Continuous monitoring over 15 minutes provides initial velocity data for kinetic parameter determination. Rigorous controls must include non-enzymatic NADPH oxidation rates for each substrate to establish accurate background correction . For substrate specificity studies, various quinones should be tested under identical conditions, with Lineweaver-Burk or Eadie-Hofstee plots used to determine Km and Vmax values. Alternative approaches include HPLC-based methods to directly quantify substrate consumption and product formation, particularly valuable for verifying the reaction mechanism. Oxygen consumption measurements using Clark-type electrodes can assess potential involvement in ROS-generating reactions, while isothermal titration calorimetry provides thermodynamic parameters of substrate binding.

How can researchers effectively design site-directed mutagenesis experiments to elucidate CbRCI35 catalytic mechanism?

Effective site-directed mutagenesis experiments for CbRCI35 should begin with comprehensive sequence alignment with homologous enzymes of known structure (like PcQOR) to identify conserved residues in the active site . Computational simulations including molecular docking and molecular dynamics should guide the selection of target residues, focusing on those predicted to interact with NADPH or quinone substrates. Strategic amino acid substitutions should include: conservative changes (e.g., Arg→Lys) to assess the importance of specific chemical properties; charge reversals (e.g., Arg→Glu) to test electrostatic contributions; and alanine scanning to eliminate side chain functions entirely. Mutations in the NADPH-binding domain should target residues predicted to interact with the nicotinamide and adenine moieties separately to dissect cofactor binding from catalysis . For the quinone-binding pocket, mutations should address residues like those homologous to R45, Q48, and Y54 in PcQOR that likely position the substrate and facilitate electron transfer . Each mutant should undergo full kinetic characterization with multiple substrates to generate structure-function relationships. Thermal stability analysis using differential scanning fluorimetry provides insights into structural impacts of mutations beyond catalytic effects. Combining mutational data with structural information enables construction of a comprehensive mechanistic model for CbRCI35-mediated quinone reduction.

How does CbRCI35 overexpression alter ROS homeostasis and enhance cold tolerance?

CbRCI35 overexpression significantly impacts ROS homeostasis through multiple mechanisms that collectively enhance cold tolerance. Transgenic plants overexpressing CbRCI35 exhibit moderately elevated basal ROS levels under normal conditions, suggesting a controlled "priming" effect that prepares cells for subsequent stress . After cold exposure, CbRCI35-overexpressing plants maintain better ROS homeostasis with superoxide dismutase (SOD) activity significantly higher than wild-type plants in both normal and chilling conditions . This enhanced antioxidant capacity prevents excessive ROS accumulation while maintaining beneficial ROS signaling. Transcriptionally, CbRCI35 overexpression alters the expression profile of ROS metabolic genes, with ROS scavenging genes (NtAPX, NtCAT, NtGST) showing lower expression in transgenic plants, while SOD shows increased expression . Importantly, ROS production modulators (NtRBOHD1 and NtRBOHD2) are downregulated under normal temperatures, and cold induction of NtRBOHD1 is significantly blocked in CbRCI35-overexpressing plants . This comprehensive reconfiguration of ROS metabolism minimizes membrane damage, as evidenced by reduced malondialdehyde (MDA) content and electrolyte leakage during cold stress, ultimately enhancing freezing resistance without compromising plant growth .

What are the molecular interactions between CbRCI35 and other components of plant stress response pathways?

CbRCI35 functions within a complex network of molecular interactions that coordinate plant stress responses. The enzyme likely interacts directly with components of the ROS sensing and signaling machinery, potentially forming protein complexes with ROS sensors or transducers that regulate signal propagation. Experimental evidence shows that CbRCI35 overexpression alters the expression of multiple downstream cold-responsive genes, suggesting interaction with transcriptional regulators either directly or through redox-mediated signaling cascades . While direct protein-protein interactions remain to be fully characterized, functional analysis demonstrates that CbRCI35 significantly influences the activity of ROS scavenging enzymes like superoxide dismutase (SOD), whose activity increases in CbRCI35-overexpressing plants . This suggests potential cross-regulation through shared signaling molecules or transcription factors. The enzyme also appears to modulate NADPH oxidase (RBOH) expression, key enzymes in stress-induced ROS production, indicating potential negative feedback regulation . CbRCI35 may additionally interact with membrane components to maintain membrane integrity during cold stress, as evidenced by reduced electrolyte leakage in plants overexpressing the enzyme .

What biotechnological applications could leverage CbRCI35 for improving crop resilience?

CbRCI35 offers significant potential for improving crop resilience through various biotechnological applications. Transgenic overexpression of CbRCI35 in crops could enhance cold tolerance without growth penalties, as demonstrated in tobacco models where CbRCI35-overexpressing plants showed significantly increased freezing resistance without observable growth retardation . This makes it particularly valuable for extending growing seasons and geographical ranges of important crop species. Gene editing approaches using CRISPR/Cas9 to modify endogenous quinone oxidoreductases to mimic the beneficial properties of CbRCI35 could enhance cold tolerance in crops where transgenic approaches face regulatory challenges. Promoter engineering to optimize CbRCI35 expression patterns—potentially creating stress-inducible or tissue-specific expression—could fine-tune stress responses while minimizing metabolic costs. Computational approaches leveraging CbRCI35's structure-function relationships could guide the design of synthetic enzymes with enhanced stability or catalytic efficiency under extreme conditions. The gene could also serve as a molecular marker for breeding programs aimed at enhancing abiotic stress tolerance, particularly in temperate crops where early or late season cold snaps cause significant yield losses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.