Recombinant Capsella bursa-pastoris NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Capsella bursa-pastoris NAD(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic

Recombinant Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (UniProt ID: A4QKP7) is a chloroplast-targeted enzyme involved in electron transport pathways. Produced heterologously in E. coli, this 101-amino acid protein belongs to the NAD(P)H dehydrogenase (NDH) complex, which mediates photosystem I (PSI) cyclic electron flow and chlororespiratory processes in plants . Its recombinant form includes an N-terminal His tag for purification and research applications .

Production and Purification

The protein is expressed in E. coli and purified via affinity chromatography leveraging the His tag . Critical handling notes include:

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles; store aliquots at -20°C/-80°C .

Functional Role in Chloroplasts

As part of the NDH complex, this subunit contributes to:

  1. Cyclic Electron Flow: Facilitates PSI-dependent ATP synthesis by recycling electrons .

  2. Reactive Electrophile Detoxification: Reduces toxic α,β-unsaturated carbonyls (e.g., γ-ketols) via NADPH-dependent activity, analogous to related quinone oxidoreductases .

  3. Antioxidant Regulation: Maintains plastoquinone (PQ) pool redox balance, critical for mitigating oxidative stress in thylakoid membranes .

Research Applications

Application AreaUse Case
Enzyme KineticsSubstrate specificity studies using NADPH/NADH as cofactors .
Structural BiologyCryo-EM analysis of chloroplast NDH complex architecture .
Oxidative StressInvestigating detoxification mechanisms of lipid peroxidation products .
Diagnostic ToolsTarget antigen in ELISA kits for protein quantification .

Comparative Insights from Homologs

  • Barley NDH Complex: Subunit 4L interacts with subunits F, 6, H, I, and K to form a membrane-embedded proton translocation module .

  • Arabidopsis NDC1: A paralog involved in non-photochemical PQ reduction, highlighting functional conservation across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All protein shipments are delivered with standard blue ice packs. Should you require dry ice delivery, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 4L in Capsella bursa-pastoris and what is its primary function?

NAD(P)H-quinone oxidoreductase subunit 4L (encoded by the ndhE gene) is a chloroplastic protein that functions as a component of the NAD(P)H dehydrogenase complex in the thylakoid membrane. This complex catalyzes the reduction of plastoquinone and participates in cyclic electron flow around photosystem I and chlororespiration. The protein contains approximately 100-110 amino acid residues and features transmembrane domains that anchor it within the thylakoid membrane. Based on homologous proteins, it likely participates in the two-electron reduction of quinones to hydroquinones, which prevents the formation of deleterious radical species through one-electron reduction pathways .

The subunit 4L serves as an integral component of the multisubunit NDH complex, contributing to both its structural stability and electron transfer functions. In plants, this complex plays crucial roles in photoprotection during environmental stress conditions by facilitating alternative electron transport routes and maintaining redox balance within the chloroplast.

How does the sequence and structure of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L compare with homologs from other plant species?

Based on comparative analysis with homologous proteins, Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L likely shares significant sequence similarity with other plant species, particularly those within the Brassicaceae family. The protein typically contains membrane-spanning alpha-helical domains with conserved residues essential for quinone binding and electron transfer functions.

When comparing with the Buxus microphylla homolog, researchers can anticipate a similar amino acid sequence pattern, characterized by hydrophobic residues in the transmembrane regions and conserved functional motifs involved in cofactor interactions . The expected sequence length would be approximately 100-110 amino acids, with significant conservation in the quinone-binding domains and electron transfer pathways.

Predicted structural features would include:

  • Multiple transmembrane helices traversing the thylakoid membrane

  • Conserved residues for quinone interaction

  • Domains for association with other NDH complex subunits

  • Potential sites for post-translational modifications

What is the genetic organization of the ndhE gene encoding the NAD(P)H-quinone oxidoreductase subunit 4L in Capsella bursa-pastoris?

The ndhE gene in Capsella bursa-pastoris is located within the chloroplast genome, consistent with its role in photosynthetic electron transport. The gene likely lacks introns, as is typical for chloroplast-encoded genes, and is transcribed as part of polycistronic transcription units with other ndh genes. The genetic context often includes neighboring genes involved in similar functions within the photosynthetic apparatus .

The expression of ndhE is coordinated with other components of the NDH complex and is regulated in response to environmental conditions, particularly light intensity, temperature fluctuations, and drought stress. Researchers investigating this gene should consider its chloroplastic location when designing experimental approaches, including DNA extraction methods specific for organellar genomes and appropriate PCR primers that account for the unique sequence characteristics of chloroplast genes.

What are the optimal expression systems for producing recombinant Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L?

For recombinant expression of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L, several expression systems can be employed, with E. coli being the most commonly utilized platform. Based on successful approaches with homologous proteins, the following methodological considerations are recommended:

E. coli Expression System:

  • Bacterial strains: BL21(DE3), Rosetta(DE3), or C41(DE3) for membrane proteins

  • Expression vectors: pET series with T7 promoter, particularly pET-28a(+) for N-terminal His-tagging

  • Induction conditions: 0.1-0.5 mM IPTG at reduced temperatures (16-20°C) to enhance proper folding

  • Media supplementation: Consider adding riboflavin (10 μM) to enhance flavin incorporation if needed

Alternative Expression Systems:

  • Insect cell/baculovirus system for complex membrane proteins requiring eukaryotic processing

  • Cell-free expression systems when protein toxicity is problematic

The selection of an appropriate expression system should be guided by experimental objectives, considering factors such as required protein yield, structural integrity, and downstream applications. For structural studies or enzymatic assays, E. coli expression with appropriate optimization typically yields sufficient quantities of functional protein.

What purification strategies yield the highest purity and activity for recombinant Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L?

Purification of recombinant Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L requires a systematic approach designed to maintain protein stability while achieving high purity. The following multi-step purification protocol is recommended based on successful strategies with homologous proteins:

Step 1: Initial Extraction

  • For His-tagged proteins: Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF, and appropriate detergents (e.g., 0.5-1.0% Triton X-100 or n-dodecyl β-D-maltoside)

  • Include protease inhibitors to prevent degradation during extraction

Step 2: Affinity Chromatography

  • Utilize Ni-NTA resin for His-tagged proteins

  • Apply stepwise imidazole gradient: wash with 20-40 mM imidazole, elute with 250-300 mM imidazole

  • Buffer conditions: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 0.05% appropriate detergent

Step 3: Additional Purification

  • Size exclusion chromatography using Superdex 75/200 columns to separate monomeric protein from aggregates

  • Ion exchange chromatography if additional purity is required

Step 4: Final Preparation

  • Buffer exchange to remove imidazole: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol

  • Concentrate using 10 kDa MWCO centrifugal filters

  • Store at -80°C in small aliquots to avoid freeze-thaw cycles

The quality of purified protein should be assessed using SDS-PAGE (>90% purity), Western blotting, and activity assays specific for NAD(P)H-quinone oxidoreductase function.

How can researchers overcome challenges in maintaining stability and activity of the purified recombinant protein?

Maintaining stability and activity of purified recombinant Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L presents several challenges due to its membrane-associated nature and sensitivity to oxidation. The following strategies address common stability issues:

Buffer Optimization:

  • Include 6% trehalose as a stabilizing agent in storage buffers

  • Maintain pH between 7.5-8.0 (typically with Tris or phosphate buffers)

  • Add reducing agents (1-5 mM DTT or 1-2 mM β-mercaptoethanol) to prevent oxidation

  • Consider inclusion of 10-15% glycerol to prevent aggregation

Storage Recommendations:

  • Lyophilize in the presence of stabilizers for long-term storage

  • For solution storage, maintain at -80°C in small aliquots

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • For experimental use, store working aliquots at 4°C for no more than one week

Activity Preservation:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for aliquots intended for long-term storage

  • Monitor activity periodically using standard enzymatic assays to confirm stability

Critical Handling Practices:

  • Brief centrifugation of protein vials before opening to collect contents

  • Gentle mixing rather than vortexing to prevent protein denaturation

  • Temperature control during all handling steps to minimize degradation

These precautions collectively protect against common degradation pathways and maintain the structural and functional integrity of the purified protein for downstream applications.

What assay methods can accurately measure the enzymatic activity of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L?

Accurate measurement of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L activity requires specialized assays that account for its unique electron transfer properties. The following methodological approaches are recommended:

Spectrophotometric Assays:

  • NAD(P)H Oxidation Assay:

    • Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Reaction mixture: 50 mM Tris-HCl (pH 7.5), 0.1 mM NAD(P)H, 0.01-0.1 mM quinone substrate

    • Calculate activity as μmol NAD(P)H oxidized/min/mg protein

  • Cytochrome c Reduction Assay:

    • Monitor increase in absorbance at 550 nm

    • Reaction mixture: 50 mM phosphate buffer (pH 7.4), 0.1 mM NAD(P)H, appropriate quinone, 0.07 mM cytochrome c

    • Particularly useful for comparative studies with homologous enzymes

Oxygen Consumption Assays:

  • Measure oxygen uptake using Clark-type electrode

  • Reaction conditions: 25°C in 50 mM potassium phosphate (pH 7.4) with NAD(P)H and quinone substrates

  • Applicable for studying redox cycling reactions

Substrate Specificity Analysis:

  • Test panel of quinones (menadione, duroquinone, benzoquinone, etc.)

  • Determine kinetic parameters (Km, Vmax) for each substrate

  • Compare relative activities to build substrate preference profile

Researchers should note that as NAD(P)H-quinone oxidoreductase subunit 4L operates in a multisubunit complex, activity assays using the isolated subunit may yield different results compared to the intact NDH complex.

How does substrate specificity of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L compare with homologous enzymes from other species?

Understanding the substrate specificity of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L provides insights into its evolutionary adaptations and functional roles. Based on comparative analysis with homologous enzymes, the following substrate specificity patterns can be anticipated:

Table 1: Comparative Substrate Specificity of NAD(P)H-Quinone Oxidoreductases

SubstrateCapsella bursa-pastoris*Buxus microphyllaHuman QR1Mouse QR1Rat QR1
Menadione (Vitamin K₃)++++++++++++++
Duroquinone+++++++++++++++
Plastoquinone+++++++++++
Ubiquinone+++++++++++++
Benzoquinone+++++++++++++++
Dichlorophenolindophenol++++++++++++++++

*Predicted activity levels based on homologous plant enzymes:

  • = Low activity
    ++ = Moderate activity
    +++ = High activity
    ++++ = Very high activity

The plant chloroplastic enzymes typically show higher activity with plastoquinone derivatives, reflecting their role in photosynthetic electron transport. In contrast, mammalian enzymes (human, mouse, rat) demonstrate broader substrate specificity with higher activity toward xenobiotic quinones, consistent with their detoxification functions .

Key differences likely include:

  • Higher selectivity for plastoquinone in plant enzymes

  • Different kinetic parameters (Km, kcat) for common substrates

  • Variable sensitivity to inhibitors

  • Different optimal pH and temperature ranges for activity

These differences reflect the evolutionary adaptations to specific physiological roles and cellular environments.

What role does the Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L play in stress response mechanisms within the chloroplast?

The Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L plays critical roles in plant stress response mechanisms through its participation in the chloroplast NDH complex. Under various stress conditions, this protein contributes to:

Photoprotection During Light Stress:

  • Facilitates cyclic electron flow around Photosystem I

  • Alleviates excess excitation pressure

  • Contributes to non-photochemical quenching mechanisms

  • Prevents photo-oxidative damage to the photosynthetic apparatus

Response to Temperature Extremes:

  • Maintains electron flow during cold stress

  • Contributes to thermal energy dissipation during heat stress

  • Stabilizes thylakoid membrane integrity under temperature fluctuations

Drought and Salinity Stress Adaptation:

  • Promotes ATP generation through cyclic electron flow

  • Contributes to chlororespiration during water limitation

  • Helps maintain proton gradient across thylakoid membranes

  • Supports stomatal regulation indirectly through energy balance maintenance

Oxidative Stress Management:

  • Prevents formation of reactive oxygen species by ensuring complete two-electron reduction of quinones

  • Reduces oxidative damage to chloroplast proteins and lipids

  • Participates in redox signaling pathways that activate stress response genes

Experimental evidence from homologous systems indicates that plants with impaired NDH complex function show increased sensitivity to environmental stresses, particularly under fluctuating light conditions or during drought. This suggests that the NAD(P)H-quinone oxidoreductase subunit 4L represents a valuable target for engineering enhanced stress tolerance in crops.

What structural features of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L are critical for its catalytic function?

The catalytic function of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L depends on specific structural features that facilitate electron transfer and substrate binding. Based on homologous proteins, the following structural elements are likely critical:

Transmembrane Domains:

  • The protein contains multiple transmembrane α-helices that anchor it within the thylakoid membrane

  • These helices create a hydrophobic environment necessary for quinone binding

  • Proper membrane integration is essential for interaction with other NDH complex subunits

Quinone Binding Site:

  • Contains a combination of hydrophobic residues forming a pocket for quinone ring accommodation

  • Includes specific aromatic residues (likely Trp, Phe, Tyr) that form π-stacking interactions with the quinone

  • Key hydrogen bonding residues coordinate with the quinone oxygen atoms

Electron Transfer Pathways:

  • Strategic positioning of electron transfer components with optimal distances (typically 3.5-4.5 Å)

  • Conserved residues that facilitate direct hydride transfer

  • Potential water-mediated hydrogen bonding networks that support electron movement

Subunit Interface Regions:

  • Surface residues that mediate specific interactions with adjacent subunits

  • These interactions stabilize the multiprotein complex and create functional electron transfer pathways

  • Specific charged and polar residues at interfaces maintain proper quaternary structure

Mutational studies of homologous proteins suggest that alterations to these key structural features, particularly in the quinone binding pocket or at subunit interfaces, significantly impair catalytic activity and complex stability.

How can researchers effectively map the protein-protein interactions within the NDH complex involving the NAD(P)H-quinone oxidoreductase subunit 4L?

Mapping protein-protein interactions involving Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L requires specialized approaches that address the challenges of studying membrane protein complexes. The following methodological strategies are recommended:

In Vivo Approaches:

  • Split-Ubiquitin Yeast Two-Hybrid System:

    • Specifically designed for membrane protein interactions

    • Fusion of bait and prey to distinct ubiquitin fragments

    • Interaction produces functional ubiquitin recognized by proteases

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to potential interaction partners

    • Reconstitution of fluorescence when proteins interact

    • Allows visualization of interactions in native cellular context

In Vitro Approaches:

  • Co-Immunoprecipitation with Crosslinking:

    • Chemical crosslinking to stabilize transient interactions

    • Pull-down with antibodies against NAD(P)H-quinone oxidoreductase subunit 4L

    • Mass spectrometry analysis of co-precipitated proteins

  • Surface Plasmon Resonance (SPR):

    • Immobilization of purified NAD(P)H-quinone oxidoreductase subunit 4L

    • Measurement of binding kinetics with other purified NDH subunits

    • Determination of affinity constants and binding dynamics

Structural Approaches:

  • Cryo-Electron Microscopy:

    • Analysis of intact NDH complex structure

    • Identification of subunit arrangement and contact points

    • Resolution of interaction interfaces at near-atomic resolution

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Identification of protected regions upon complex formation

    • Mapping of interaction surfaces

    • Analysis of conformational changes induced by binding

  • Cross-linking Mass Spectrometry:

    • Application of bifunctional crosslinkers to stabilize interactions

    • Identification of crosslinked peptides by mass spectrometry

    • Determination of spatial proximity between protein regions

These complementary approaches provide a comprehensive map of the interaction network within the NDH complex, revealing both direct and indirect associations with NAD(P)H-quinone oxidoreductase subunit 4L.

What computational approaches can predict the tertiary structure of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L in the absence of crystallographic data?

In the absence of direct crystallographic data, several computational approaches can be employed to predict the tertiary structure of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L with reasonable accuracy. These methods leverage existing knowledge of homologous proteins and physicochemical principles:

Homology Modeling Approaches:

  • Template Selection:

    • Identify structurally characterized homologs from other species (particularly plant NAD(P)H-quinone oxidoreductases)

    • Assessment of sequence identity/similarity (optimal >30% identity)

    • Evaluation of template quality (resolution, completeness)

  • Model Building Pipeline:

    • Sequence alignment between target and template

    • Backbone generation based on aligned regions

    • Loop modeling for non-aligned segments

    • Side chain placement and optimization

    • Energy minimization to refine the structure

Machine Learning-Based Prediction:

  • AlphaFold2 and RoseTTAFold:

    • State-of-the-art deep learning approaches

    • Multiple sequence alignment information integration

    • Attention-based neural networks for structure prediction

    • Confidence metrics (pLDDT scores) for model evaluation

  • META Approach:

    • Consensus predictions from multiple servers

    • Integration of results from I-TASSER, SWISS-MODEL, Robetta

    • Model quality assessment using QMEANDisCo or ProQ3D

Membrane Protein-Specific Considerations:

  • Transmembrane Region Prediction:

    • TMHMM, HMMTOP or MEMSAT for transmembrane helix identification

    • Positioning within a simulated lipid bilayer using PPM server

    • Refinement with implicit membrane models

  • Model Validation for Membrane Proteins:

    • Assessment of hydrophobic surface exposure

    • Evaluation of charged residue positioning relative to membrane

    • Analysis of evolutionary conservation patterns

Molecular Dynamics Refinement:

  • Embedding the predicted structure in a realistic membrane environment

  • Simulation with explicit solvent and lipids

  • Analysis of structural stability and conformational changes

  • Refinement of interaction surfaces and binding pockets

These computational approaches, particularly when used in combination, can provide valuable structural insights that guide experimental design and functional hypotheses in the absence of direct structural determination.

How can site-directed mutagenesis be employed to investigate the catalytic mechanism of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L. Based on structural predictions and comparative analyses, researchers should target the following residue categories for mutagenesis studies:

Key Residues for Mutagenesis:

  • Putative Quinone-Binding Residues:

    • Aromatic residues (Trp, Phe, Tyr) likely involved in π-stacking with quinone rings

    • Histidine residues that may participate in hydrogen bonding with quinone oxygens

    • Glycine residues that provide structural flexibility near the binding pocket

  • Charged/Polar Residues in Predicted Active Site:

    • Conserved charged residues that may participate in proton transfer

    • Tyrosine residues that could form hydrogen bonds with substrate

    • Histidine residues potentially involved in acid-base catalysis

  • Interface Residues for Complex Assembly:

    • Conserved residues at predicted subunit interfaces

    • Charged residues that may form salt bridges with adjacent subunits

    • Hydrophobic residues at interaction surfaces

Experimental Design Strategy:

  • Mutation Design:

    • Conservative substitutions to probe specific interactions (e.g., Tyr→Phe to test hydrogen bonding)

    • Charge reversal mutations to disrupt electrostatic interactions

    • Alanine scanning of predicted binding pocket residues

  • Functional Characterization:

    • Steady-state kinetic analysis with various substrates

    • Pre-steady-state kinetics to resolve individual reaction steps

    • pH-dependence studies to identify catalytically essential ionizable groups

    • Temperature-dependent studies to assess thermodynamic parameters

  • Structural Analysis:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess conformational changes

    • Thermal stability measurements to evaluate structural integrity

Expected Outcomes and Interpretation:

  • Residues critical for catalysis will show dramatic activity reduction when mutated

  • Substrate binding residues may show altered Km without affecting kcat

  • Interface residues may affect complex assembly without directly impacting catalytic constants

  • Some mutations may reveal unexpected roles in long-range effects on enzyme function

This systematic mutagenesis approach will provide detailed insights into the catalytic mechanism, delineating residues involved in substrate binding, electron transfer, and complex assembly.

What are the most effective approaches for studying the role of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L in vivo?

Investigating the in vivo role of Capsella bursa-pastoris NAD(P)H-quinone oxidoreductase subunit 4L requires specialized techniques that address the challenges of studying chloroplast-encoded proteins in their native context. The following methodological approaches are recommended:

Genetic Manipulation Strategies:

  • Chloroplast Transformation:

    • Biolistic delivery of constructs targeting the ndhE gene

    • Homologous recombination-based gene replacement

    • Selection using spectinomycin resistance markers

    • Confirmation of homoplasmy via PCR and Southern blotting

  • CRISPR-Cpf1 Chloroplast Genome Editing:

    • Design of guide RNAs targeting ndhE

    • Introduction of specific mutations or deletions

    • Phenotypic characterization of transformants

  • Antisense RNA Approach:

    • Expression of chloroplast-targeted antisense RNA from nuclear genome

    • Reduction of target protein levels without complete elimination

    • Useful for dose-dependent functional studies

Functional Phenotyping Methods:

  • Photosynthetic Parameter Analysis:

    • Chlorophyll fluorescence (OJIP transients, NPQ, Fv/Fm)

    • P700 redox kinetics to assess PSI electron flow

    • Measurement of proton motive force using electrochromic shift

    • Determination of ATP/NADPH ratios under varying conditions

  • Stress Response Characterization:

    • Controlled exposure to environmental stressors (high light, drought, temperature extremes)

    • Measurement of stress markers (ROS, lipid peroxidation, antioxidant enzymes)

    • Growth and development analysis under stress conditions

    • Recovery kinetics following stress exposure

  • Metabolic Profiling:

    • Targeted analysis of photosynthetic intermediates

    • Untargeted metabolomics to identify broader metabolic impacts

    • 13C-labeling studies to trace carbon flow through photosynthetic pathways

Protein-Level Characterization:

  • In vivo Protein Complex Analysis:

    • Blue-native PAGE to assess NDH complex assembly

    • Co-immunoprecipitation with antibodies against other NDH subunits

    • Pulse-chase labeling to study complex assembly kinetics

    • Fractionation of thylakoid membranes to localize complexes

  • In situ Localization:

    • Immunogold electron microscopy

    • Development of fluorescent protein fusions for confocal microscopy

    • Super-resolution microscopy to determine precise suborganellar localization

How can comparative studies between different plant species enhance our understanding of NAD(P)H-quinone oxidoreductase subunit 4L evolution and specialization?

Comparative studies across plant species provide valuable insights into the evolution, functional specialization, and adaptive significance of NAD(P)H-quinone oxidoreductase subunit 4L. The following approaches leverage evolutionary diversity to enhance our understanding of this protein:

Phylogenetic Analysis Approaches:

  • Comprehensive Sequence Sampling:

    • Collection of ndhE sequences from diverse plant lineages (algae to angiosperms)

    • Inclusion of representatives from major photosynthetic groups

    • Particular focus on species with specialized photosynthetic adaptations (C4, CAM)

  • Evolutionary Rate Analysis:

    • Calculation of dN/dS ratios to identify selection pressures

    • Identification of conserved vs. variable regions

    • Detection of lineage-specific accelerated evolution

    • Correlation with ecological adaptations and photosynthetic strategy

  • Ancestral Sequence Reconstruction:

    • Inference of ancestral protein sequences at key evolutionary nodes

    • Resurrection of ancestral proteins through recombinant expression

    • Functional characterization to trace evolutionary trajectories

Structural Comparison Methods:

  • Homology Modeling Across Lineages:

    • Generation of structural models for diverse plant species

    • Comparison of predicted binding sites and interaction surfaces

    • Identification of structural features associated with functional adaptation

  • Molecular Dynamics Simulations:

    • Comparative analysis of protein dynamics across species

    • Investigation of lineage-specific flexibility/rigidity patterns

    • Correlation between structural dynamics and environmental adaptations

Functional Comparative Analysis:

  • Cross-Species Expression Studies:

    • Expression of NAD(P)H-quinone oxidoreductase subunit 4L from diverse species in a common host

    • Comparison of biochemical properties (substrate specificity, kinetic parameters)

    • Evaluation of thermal stability and stress resistance across homologs

  • Chimeric Protein Analysis:

    • Creation of domain-swapped variants between species

    • Identification of regions responsible for species-specific properties

    • Mapping of functional domains through systematic domain exchanges

Ecological and Evolutionary Context:

  • Correlation with Habitat and Photosynthetic Adaptation:

    • Comparison between species from different ecological niches

    • Analysis of variants from plants with C3, C4, and CAM photosynthesis

    • Examination of species from extreme environments (high light, drought, cold)

  • Integration with Whole-Plant Physiology:

    • Comparison of photosynthetic performance metrics across species

    • Association between ndhE sequence features and physiological traits

    • Identification of adaptive patterns across environmental gradients

These comparative approaches collectively reveal how evolutionary processes have shaped NAD(P)H-quinone oxidoreductase subunit 4L structure and function across plant lineages, providing insights into adaptive mechanisms and potential applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.