Recombinant Capsella bursa-pastoris Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Expression Systems:

  • Prokaryotic: E. coli is the primary host due to cost-effectiveness and high yield .

  • Eukaryotic: Yeast or mammalian systems are used for post-translational modifications, though less common for chloroplast proteins .

Purification:

  • Affinity chromatography (e.g., Ni-NTA for His-tagged proteins).

  • Buffer composition: Tris/PBS-based with 6% trehalose (pH 8.0) to enhance stability .

Functional Role in Photosynthesis

  • PSII Assembly: PsbB cooperates with PsbH and other subunits to form the PSII reaction center. Mutations in psbB disrupt CP47 synthesis, impairing PSII monomer formation and chlorophyll binding .

  • Light Harvesting: Binds 14–16 chlorophyll a molecules, enabling energy transfer to the reaction center .

  • Oxidative Stress Response: Critical for maintaining PSII stability under high-light conditions .

Research Applications

Biochemical Studies:

  • Used to investigate PSII assembly mutants (e.g., fpb1 in Arabidopsis) that reduce CP47 synthesis rates .

  • Assays for chlorophyll-protein interactions and photochemical efficiency .

Biotechnological Applications:

  • Potential use in bioenergy research to optimize photosynthetic efficiency in crops .

Challenges and Future Directions

  • Sequence Variability: Cross-species differences (e.g., Lactuca sativa vs. Capsella) necessitate species-specific recombinant models .

  • Tag Interference: N-/C-terminal tags may affect protein folding; tag-free variants are under development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAAAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function

Recombinant Capsella bursa-pastoris Photosystem II CP47 chlorophyll apoprotein (psbB) is a core component of the photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Capsella bursa-pastoris and why is it valuable for photosystem protein research?

Capsella bursa-pastoris (shepherd's purse) is a medicinal plant recently introduced to European Pharmacopoeia that belongs to the Brassicaceae family. It contains numerous bioactive compounds including flavonoids, phenolic acids, amino acids, phytosterols, vitamins, and bioelements . As an allotetraploid species resulting from hybridization between ancestors of Capsella grandiflora and Capsella orientalis, it possesses a complex genome with multiple gene copies . This genomic architecture makes it particularly valuable for studying photosystem protein evolution, as researchers can investigate how duplicate genes encoding photosystem components have diverged functionally after hybridization events. Additionally, its widespread global distribution across different environments provides an opportunity to study environmental adaptation of photosynthetic machinery.

What is the function of CP47 chlorophyll apoprotein (psbB) in photosystem II and why study its recombinant form?

CP47 chlorophyll apoprotein (encoded by the psbB gene) serves as a core antenna protein in photosystem II, binding multiple chlorophyll molecules that capture light energy and transfer it to the reaction center. Studying the recombinant form of this protein from Capsella bursa-pastoris offers several advantages: (1) it allows isolation of this specific component from the complex photosystem structure for detailed biochemical and biophysical characterization; (2) it enables investigation of how allopolyploidy affects photosystem protein structure and function, as C. bursa-pastoris likely possesses homeologous copies of psbB from different parental genomes ; and (3) it facilitates comparison of CP47 variants across the distinct genetic clusters identified in Eurasian C. bursa-pastoris populations, potentially revealing signatures of local adaptation in photosynthetic machinery.

How does Capsella bursa-pastoris genomic architecture affect psbB gene expression and protein function?

As an allotetraploid species, Capsella bursa-pastoris contains two subgenomes derived from different parental species . This genomic structure likely results in homeologous copies of the psbB gene, potentially leading to expression of multiple CP47 protein variants within the same cells. Researchers should consider several implications: first, expression bias may favor one homeolog over another, either constitutively or in response to specific environmental conditions; second, protein variants with slightly different sequences may exhibit altered chlorophyll binding properties or interactions with other photosystem components; and third, the presence of multiple gene copies might provide functional redundancy, potentially allowing one copy to evolve new specializations while the other maintains the original function. Understanding these dynamics is crucial when designing experiments with recombinant CP47 proteins.

What expression systems are most suitable for producing functional recombinant CP47 protein from Capsella bursa-pastoris?

When selecting an expression system for recombinant CP47 production, researchers should consider several factors unique to this chlorophyll-binding membrane protein. Plant-based expression systems often provide the most appropriate cellular environment, as they contain the necessary machinery for chlorophyll synthesis and membrane protein folding. Capsella bursa-pastoris tissue culture systems have been established using various explant types, with hypocotyls showing optimal performance for callus induction and subculture on Murashige and Skoog (MS) medium supplemented with 2-3 mg/L 6-benzylaminopurine and 0.2-0.6 mg/L 1-naphthylacetic acid . These systems could potentially be adapted for homologous expression of CP47. Alternatively, Arabidopsis thaliana or Nicotiana benthamiana transient expression systems might serve as suitable heterologous hosts, given their close evolutionary relationship to C. bursa-pastoris and well-established transformation protocols.

How should researchers approach the isolation and purification of recombinant CP47 while maintaining protein integrity?

Isolating functional CP47 protein presents significant challenges due to its membrane-embedded nature and chlorophyll binding properties. A recommended protocol involves: (1) gentle tissue disruption in buffer containing protease inhibitors and antioxidants (leveraging C. bursa-pastoris's own antioxidant compounds could be beneficial ); (2) differential centrifugation to isolate thylakoid membranes; (3) solubilization using mild detergents like n-dodecyl-β-D-maltoside that preserve protein-pigment interactions; (4) affinity chromatography utilizing engineered tags or antibodies against CP47; and (5) size exclusion chromatography to obtain pure protein complexes. Throughout this process, samples should be protected from strong light and maintained at low temperature to prevent chlorophyll degradation and protein denaturation. Researchers should verify protein integrity via absorption spectroscopy to confirm chlorophyll retention and proper folding.

What are the optimal methods for assessing chlorophyll binding properties of recombinant CP47 protein?

Evaluating chlorophyll binding properties of recombinant CP47 requires a multi-faceted approach combining spectroscopic, biochemical, and structural methods. Absorption spectroscopy (350-750 nm range) provides a primary assessment, with characteristic peaks at approximately 440 nm and 675 nm indicating bound chlorophyll a. Circular dichroism spectroscopy can reveal information about protein secondary structure and pigment-protein interactions. Fluorescence spectroscopy, particularly when combined with time-resolved measurements, allows analysis of energy transfer efficiency between chlorophyll molecules. Pigment extraction and HPLC analysis can quantify chlorophyll:protein ratios and identify specific chlorophyll species. For more detailed structural information, techniques like native mass spectrometry can determine the exact number of bound pigments, while cryo-electron microscopy or X-ray crystallography (though challenging) would provide atomic-level details of chlorophyll binding sites in the protein.

How can researchers distinguish between homeologous psbB genes in Capsella bursa-pastoris for recombinant expression studies?

Distinguishing between homeologous psbB genes derived from the different parental genomes in C. bursa-pastoris requires a systematic approach. First, researchers should perform targeted sequencing of the psbB locus from multiple individuals, followed by comparative sequence analysis with the diploid progenitor species C. grandiflora and C. orientalis . Diagnostic single nucleotide polymorphisms (SNPs) that differentiate the homeologs should be identified and used to design homeolog-specific primers for amplification and cloning. RNA-seq data can help determine expression levels of each homeolog and identify any potential alternative splicing. For functional studies, researchers should create separate constructs for each homeolog, potentially with different tags to allow distinction in co-expression experiments. When interpreting results, the evolutionary history of C. bursa-pastoris populations must be considered, as genetic exchange between populations with different colonization histories could have created novel combinations of psbB alleles .

How do environmental adaptations across Capsella bursa-pastoris populations manifest in psbB sequence and expression variation?

The distinct genetic clusters identified in Eurasian C. bursa-pastoris populations (Western Europe/Southeastern Siberia, Eastern Asia, and Middle East) likely reflect adaptation to different environmental conditions, which may include adaptations in photosynthetic machinery. To investigate this, researchers should collect C. bursa-pastoris samples across environmental gradients within each genetic cluster and sequence both psbB homeologs. Sequence variations should be analyzed for signatures of selection using methods like dN/dS ratios or McDonald-Kreitman tests. RNA-seq or qPCR can quantify expression levels of each homeolog across environments and growth conditions, potentially revealing environment-dependent expression patterns. Protein-level studies examining thermal stability, pH optimum, or light response curves of CP47 from different populations could connect sequence variations to functional differences. Statistical approaches like environmental association analysis can identify specific environmental variables (light intensity, temperature regimes, drought conditions) that correlate with genetic variations in psbB, suggesting causal relationships in adaptive evolution.

What experimental designs can effectively test the functional consequences of psbB sequence variations among Capsella bursa-pastoris populations?

To test functional consequences of psbB sequence variations, researchers should employ a complementary set of approaches spanning multiple biological scales. At the protein level, recombinant CP47 variants representing different populations should be produced and characterized for chlorophyll binding affinity, protein stability, and interaction with other photosystem components using biophysical methods. To assess physiological effects, researchers can develop a heterologous complementation system where psbB variants are expressed in a model organism (e.g., Synechocystis) with its native psbB deleted, followed by measurement of photosynthetic parameters. For in planta studies, CRISPR-Cas9 gene editing could replace one psbB variant with another in C. bursa-pastoris, followed by growth experiments under different environmental conditions. Reciprocal transplant experiments with natural C. bursa-pastoris populations from different genetic clusters would reveal how psbB variants contribute to local adaptation. Finally, ancestral sequence reconstruction could illuminate the evolutionary trajectory of psbB following allopolyploidization.

How can researchers differentiate between effects of psbB sequence variation and post-translational modifications on CP47 function?

Distinguishing between sequence-based and post-translational effects on CP47 function requires a strategic experimental approach. Researchers should first produce recombinant CP47 variants with identical post-translational modification (PTM) profiles by expressing them in the same system under identical conditions. Parallel mass spectrometry analysis should map all PTMs present. If functional differences persist under these conditions, they likely derive from sequence variations. Conversely, to isolate PTM effects, site-directed mutagenesis can be used to create proteins with identical sequences but altered PTM sites. Phosphorylation, one of the most common PTMs, can be manipulated using phosphatase treatments or phosphomimetic mutations. To detect environmentally-induced PTM differences, CP47 from C. bursa-pastoris plants grown under various stress conditions should be analyzed. The allotetraploid nature of C. bursa-pastoris adds complexity, as homeologous CP47 variants might undergo different PTM patterns; this could be investigated using homeolog-specific antibodies for immunoprecipitation followed by PTM analysis.

What statistical approaches best analyze the relationship between genetic variation in psbB and photosynthetic performance across populations?

Analyzing the relationship between psbB genetic variation and photosynthetic performance across C. bursa-pastoris populations requires sophisticated statistical methods that account for the species' complex population structure . Researchers should begin with population genetics statistics (FST, nucleotide diversity) to quantify differentiation in psbB sequences between the identified genetic clusters. Mixed linear models that incorporate population structure as random effects can prevent false associations between genetic variants and phenotypes. For complex photosynthetic traits influenced by multiple genetic factors, multivariate approaches like redundancy analysis or structural equation modeling should be employed to disentangle relationships between genetic, environmental, and phenotypic variables. Bayesian hierarchical models can incorporate prior knowledge about protein structure-function relationships. When comparing homeologous copies, paired statistical tests should be used to analyze differences in sequence conservation, expression levels, or functional parameters. Finally, time-series analyses may reveal differential responses of psbB variants to fluctuating environmental conditions.

How should researchers interpret contradictory results between in vitro and in vivo studies of recombinant CP47 function?

Contradictions between in vitro and in vivo studies of recombinant CP47 function should be systematically analyzed rather than dismissed. Researchers should first verify protein integrity in both contexts, as differences in folding, chlorophyll content, or aggregation state could explain functional discrepancies. The lipid environment significantly affects membrane protein function; therefore, reconstitution experiments using lipid compositions mimicking native thylakoid membranes might bridge in vitro-in vivo gaps. The protein complement surrounding CP47 differs between isolated protein and intact photosystems; adding purified interaction partners incrementally to in vitro assays could identify which proteins are necessary for native-like function. Differences in redox environment, ion concentrations, or molecular crowding between test tube and chloroplast might also explain discrepancies. Researchers should note that C. bursa-pastoris embryos growing in vitro versus in situ show significant developmental differences , suggesting that similar context-dependent effects might occur at the protein level. Finally, when multiple CP47 variants exist due to C. bursa-pastoris's allotetraploid nature , researchers must ensure they're comparing the same variant across systems.

How can Capsella bursa-pastoris biotechnology systems be optimized for recombinant photosystem protein production?

Optimizing C. bursa-pastoris biotechnology systems for recombinant photosystem protein production requires building upon established tissue culture methods while incorporating specific adaptations for photosynthetic proteins. Researchers should start with the proven callus induction system using hypocotyls on MS medium with 6-BA and NAA , then modify it by supplementing with chlorophyll precursors like δ-aminolevulinic acid to enhance pigment synthesis. Light conditions should be carefully controlled, as embryo development in C. bursa-pastoris is affected by light exposure . Testing different promoters, including native psbB promoters from both subgenomes and inducible promoters for temporal control, will help maximize expression. The antimicrobial properties of C. bursa-pastoris extracts could be leveraged to develop selection systems or prevent contamination in culture. Protoplast systems, which have shown success in this species , offer another promising approach for transformation and protein expression. Finally, researchers should explore whether the stress tolerance mechanisms that enable C. bursa-pastoris's broad environmental adaptation might also provide advantages for recombinant protein stability and yield.

What insights can comparative studies of CP47 across Capsella species provide for photosystem engineering?

Comparative studies of CP47 across Capsella species represent a valuable approach for informing photosystem engineering efforts. By comparing CP47 from allotetraploid C. bursa-pastoris with its diploid progenitors C. grandiflora and C. orientalis , researchers can identify how hybridization and polyploidization affect photosystem protein evolution and function. Specific insights might include: (1) identification of sequence regions under purifying selection, highlighting functionally critical domains versus those with greater flexibility for engineering; (2) discovery of natural variations that enhance particular properties like light harvesting efficiency or stress tolerance; (3) understanding how homeologous proteins interact when expressed in the same organism, informing the design of multi-protein engineering strategies; and (4) revealing how regulatory adaptations fine-tune photosystem protein expression across environments. The widespread distribution of C. bursa-pastoris across Eurasia with distinct genetic clusters provides a natural experiment in photosystem adaptation to different light environments, temperatures, and precipitation patterns—knowledge that could inform the design of photosystems optimized for specific conditions.

How might understanding CP47 variants in Capsella bursa-pastoris contribute to improving crop photosynthetic efficiency?

Understanding CP47 variants in C. bursa-pastoris could contribute to crop improvement strategies in several ways. First, the allotetraploid nature of C. bursa-pastoris provides a model for studying how duplicate photosystem genes can be optimized following polyploidization—relevant to many polyploid crops like wheat, cotton, and canola. Second, identifying sequence variations associated with enhanced photosynthetic performance under specific conditions (drought, high light, temperature extremes) could inform targeted editing of crop psbB genes using CRISPR-Cas9 technology. Third, understanding how homeologous CP47 variants interact might inspire strategies for engineering complementary photosystem proteins that function synergistically. Fourth, insights into the regulation of psbB expression across environments could help develop crops with dynamic photosynthetic responses to changing conditions. Finally, C. bursa-pastoris has been identified as a valuable species for biotechnology applications in creating resistant crop plant varieties in the Brassicaceae family —adding photosynthetic efficiency improvements to this repertoire could further enhance crop resilience and productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.