Recombinant Capsella bursa-pastoris Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The native D1 protein (psbA) is central to PSII’s reaction center, mediating light-driven electron transfer and oxygen evolution. Key functions include:

  • Primary Electron Donor: Part of the P680 chlorophyll pair, initiating charge separation .

  • Mn-Cluster Stability: Critical for binding the oxygen-evolving complex (OEC), enabling water oxidation .

  • Herbicide Binding: Acts as a target for inhibitors like atrazine, disrupting electron transport .

Research Insights

  • Mutational Studies: Substitutions at tyrosine residues (e.g., Y112L in Synechocystis) impair PSII activity, leading to rapid photoinhibition and altered thermoluminescence signatures .

  • Light Sensitivity: PSII lacking PsbP (a regulatory subunit) shows hypersensitivity to light, highlighting the D1 protein’s role in stabilizing the OEC .

Applications in Research and Industry

a. Structural and Functional Studies
The recombinant protein enables in vitro analysis of PSII dynamics, including:

  • Electron Transfer Efficiency: Assessing quinone-binding kinetics and herbicide interactions .

  • Protein Stability: Investigating folding and degradation pathways under stress conditions .

Biotechnological Potential

  • Crop Engineering: Insights into psbA regulation could inform strategies to enhance photosynthetic efficiency in polyploid species like Capsella bursa-pastoris, which exhibit hybrid vigor .

Comparative Analysis: Native vs. Recombinant Protein

FeatureNative D1 ProteinRecombinant D1 Protein
SourceCapsella bursa-pastoris chloroplastsE. coli expression system
Post-Translational ModsChlorophyll/pheophytin binding sitesHis-tag for purification
StabilitySusceptible to photoinhibitionEnhanced by glycerol buffer
Research UtilityLimited by isolation challengesHigh yield, reproducible batches

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Capsella bursa-pastoris and what is its role in photosynthesis?

The Photosystem Q(B) protein, also known as D1 protein or psbA, is a critical component of Photosystem II (PSII) in Capsella bursa-pastoris. This 32 kDa thylakoid membrane protein functions as part of the reaction center in PSII with the EC classification 1.10.3.9 . The protein plays an essential role in the electron transport chain during the light-dependent reactions of photosynthesis. Specifically, it contains the binding site for plastoquinone B (QB), which serves as an electron acceptor in the photosynthetic electron transport process. The D1 protein is encoded by the psbA gene in the chloroplast genome and forms the core of PSII along with the D2 protein (encoded by psbD) .

The protein's function is to facilitate electron transfer from the primary acceptor QA to QB, which then becomes fully reduced and takes up protons to form plastoquinol. This process is fundamental to establishing the proton gradient necessary for ATP synthesis during photosynthesis.

How is the psbA gene organized in the C. bursa-pastoris genome and how does it compare to related species?

The psbA gene in Capsella bursa-pastoris is located in the chloroplast genome. C. bursa-pastoris is particularly interesting from a genetic perspective as it is a recent allotetraploid, containing two subgenomes derived from its parental species . The high-quality genome assembly of C. bursa-pastoris reveals that most of its genome is organized into 16 chromosomes with an N50 of 16.6 Mb and a total length of approximately 253 Mb .

When comparing the psbA gene across related species, researchers have identified important conservation patterns, but also some variations. The genome-wide analysis demonstrated that C. bursa-pastoris has a single evolutionary origin without significant structural variations between populations . The expression of homeologs (corresponding genes from the two parental subgenomes) is mostly symmetric between the subgenomes, though some homeolog pairs show discordant expression .

What are the evolutionary implications of polyploidization on photosystem proteins in C. bursa-pastoris?

Capsella bursa-pastoris represents an excellent model organism for studying early changes following polyploidization due to its recent allotetraploid origin. Research has shown that polyploidization in C. bursa-pastoris has enhanced its plasticity of response to environmental factors such as light and temperature, contributing to the expansion of its distribution range .

The polyploidization event has led to the emergence of asymmetry in regulatory elements between the two subgenomes. Analysis of promoters within homeolog pairs with discordant expression has revealed differences in binding sites for transcription factors that control photosynthesis and plant development in response to light (PIF3, HY5) and cold stress (CBF) . These regulatory changes may have affected the expression and function of photosystem proteins, including psbA, contributing to the adaptive capabilities of C. bursa-pastoris in diverse environments.

What mutations in the psbA gene have been identified in C. bursa-pastoris and how do they affect herbicide resistance?

A significant mutation in the psbA gene has been identified in hexazinone-resistant populations of Capsella bursa-pastoris. Molecular analysis revealed a point mutation resulting in the substitution of phenylalanine (Phe) with isoleucine (Ile) at position 255 in the D1 protein . This specific mutation is located in the QB binding niche of the D1 protein, which is the target site for photosystem II-inhibiting herbicides.

The Phe255Ile mutation confers high resistance specifically to hexazinone, with resistant populations showing 22-fold greater resistance compared to susceptible populations . Interestingly, despite this significant resistance to hexazinone, the mutant populations remained susceptible to other photosystem II-inhibiting herbicides, including atrazine, diuron, and terbacil, suggesting a mutation-specific resistance mechanism rather than a broad-spectrum effect .

This specific mutation at position 255 had previously been observed in laboratory studies with Chlamydomonas reinhardtii, Synechococcus species, and Synechocystis species after site-directed mutagenesis, but the report in C. bursa-pastoris represents the first documentation of this mutation in a field-selected, herbicide-resistant plant .

How do mutations in psbA affect the protein's function and photosynthetic efficiency?

While the mutation confers a selective advantage in herbicide-treated environments, it may come with fitness costs in herbicide-free conditions, potentially including reduced photosynthetic efficiency or altered responsiveness to light conditions. The specific balance between resistance benefits and potential fitness costs would depend on the exact nature of the mutation and its position within the functional domains of the protein.

What are the most effective methods for expressing and purifying recombinant C. bursa-pastoris Photosystem Q(B) protein?

Expressing and purifying membrane proteins like the Photosystem Q(B) protein presents significant challenges due to their hydrophobic nature. Based on current methodologies, the following approaches have proven effective:

Expression Systems:

  • E. coli expression systems: Both search results and indicate successful expression of recombinant Capsella bursa-pastoris photosystem proteins in E. coli. This system offers high yield and relative simplicity .

  • Pichia pastoris expression: While not specifically mentioned for C. bursa-pastoris proteins, P. pastoris has advantages for expressing complex proteins as it allows proper protein folding and post-translational modifications .

Purification Strategy:

  • Addition of affinity tags: His-tagging at the N-terminus facilitates purification .

  • Membrane protein solubilization using appropriate detergents.

  • Affinity chromatography using metal chelate resins for His-tagged proteins.

  • Size exclusion or ion exchange chromatography for further purification.

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) improves stability for long-term storage

What analytical techniques are most suitable for studying the structure-function relationship of the Photosystem Q(B) protein?

Understanding the structure-function relationship of the Photosystem Q(B) protein requires a multidisciplinary approach combining various analytical techniques:

Structural Analysis:

  • X-ray Crystallography: To determine the three-dimensional structure at atomic resolution, particularly useful for visualizing the QB binding pocket and interaction with herbicides.

  • Cryo-Electron Microscopy (cryo-EM): Provides structural insights without the need for crystallization, increasingly important for membrane protein complexes.

  • Circular Dichroism (CD) Spectroscopy: To analyze secondary structure composition and conformational changes.

Functional Analysis:

  • Oxygen Evolution Measurements: To assess PSII activity and electron transfer efficiency.

  • Chlorophyll Fluorescence Spectroscopy: To measure various photosynthetic parameters, including quantum yield of PSII, non-photochemical quenching, and electron transport rate.

  • EPR Spectroscopy: To study electron transfer processes and detect radical intermediates.

  • Site-Directed Mutagenesis: To investigate the role of specific amino acid residues in protein function and herbicide binding.

Binding Studies:

  • Isothermal Titration Calorimetry (ITC): To quantify binding affinities of herbicides and plastoquinone.

  • Surface Plasmon Resonance (SPR): To study real-time binding kinetics.

  • Computational Docking and Molecular Dynamics: To model interactions with herbicides and predict the effects of mutations.

How can the study of psbA mutations in C. bursa-pastoris contribute to our understanding of herbicide resistance evolution?

The study of psbA mutations in Capsella bursa-pastoris, particularly the novel Phe255Ile mutation associated with hexazinone resistance, provides a valuable model for understanding the evolution of herbicide resistance in plants. This research contributes in several significant ways:

  • Mechanism Diversity: The discovery that the Phe255Ile mutation confers resistance specifically to hexazinone but not to other PS II inhibitors demonstrates the complexity and specificity of resistance mechanisms . This contrasts with other known psbA mutations that may confer broader resistance profiles.

  • Evolutionary Constraints: By studying the functional consequences of the mutation on photosynthetic efficiency, researchers can better understand the evolutionary constraints on resistance development. The balance between resistance benefit and potential fitness costs helps explain why certain mutations appear in the field while others don't.

  • Resistance Prediction: Characterizing the molecular basis of resistance allows for the development of DNA-based diagnostic tools to rapidly detect resistance in field populations, enabling more proactive resistance management.

  • Comparative Genomics: The appearance of the same Phe255Ile mutation previously observed in laboratory studies with cyanobacteria and algae, now found in field-selected C. bursa-pastoris, suggests convergent evolution at the molecular level . This provides insights into the predictability of resistance evolution.

  • Polyploidy Effects: The allotetraploid nature of C. bursa-pastoris offers an opportunity to study how polyploidy might influence the evolution of herbicide resistance, potentially through buffering effects or subgenome interactions .

What are the implications of regulatory element asymmetry in C. bursa-pastoris subgenomes for photosynthetic adaptation?

The high-quality genome assembly of Capsella bursa-pastoris has revealed emerging asymmetry in regulatory elements between its two subgenomes, with significant implications for photosynthetic adaptation :

  • Differential Gene Regulation: While most homeolog pairs show symmetric expression between subgenomes, some pairs exhibit discordant expression. Promoter analysis within these pairs has revealed asymmetry in regulatory elements, including binding sites for transcription factors involved in photosynthesis regulation .

  • Light Response Adaptation: The difference in binding sites for transcription factors controlling photosynthesis and plant development in response to light (PIF3, HY5) suggests subgenome specialization in light response pathways . This may allow for more nuanced regulation of photosynthesis under varying light conditions.

  • Temperature Adaptability: The asymmetry in binding sites for transcription factors involved in cold stress response (CBF) indicates potential differences in how the two subgenomes respond to temperature variations . This may contribute to the wide temperature tolerance observed in C. bursa-pastoris.

  • Ecological Success: The enhanced plasticity in response to light and temperature conditions likely contributed to the expansion of C. bursa-pastoris distribution range following polyploidization . This demonstrates how genomic changes following polyploidization can translate into ecological adaptability.

  • Evolutionary Trajectory: The observed regulatory asymmetry represents early stages of subgenome divergence, potentially leading to subfunctionalization or neofunctionalization of photosynthetic genes in the long term. This provides a valuable window into the early evolutionary consequences of polyploidization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.