Recombinant Capsicum annuum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMGR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
HMGR2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Capsicum annuum (Bell pepper)
Target Names
HMGR2
Target Protein Sequence
MDVRRRSEEAVYSSKVFAADEKPLKPHKQQQEEDNTLLIDASDALPLPLYFTNGLFFTMF FSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVARGNN DSWDEEDENDEQFILEEDSRRGPCAAATTLGCAVPTPPAKHIAPIVPQQPAVSIAEKPAP LVTPAASEEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVLQRITGKSLEGLPLDG FNYESILGQCCEMTIGYVQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIYAS GGATSILLRDGMTRAPCVRFGTAKRAAELKFFVEDPINFETLANVFNQSSRFARLQRIQC AIAGKNLHMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYADMDVIGISANFCSDKKPAAV NWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSALAGALGGFNAHASNI VSAVYIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSAC LNLLGVKGANREAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVNSHMKYNRSTKDVT KASS
Uniprot No.

Target Background

Function

Function: Catalyzes the synthesis of mevalonate, the crucial precursor for all isoprenoid compounds in plants.

Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does HMGR2 expression change during pathogen infection in Capsicum annuum?

    HMGR2 gene expression follows a distinct pattern during pathogen infection:

    • Rapidly induced within 1 hour after fungal pathogen exposure

    • Expression continuously increases up to 48 hours post-infection

    • Coordinates with other enzymes in the terpenoid biosynthetic pathway

    This expression pattern differs from constitutive HMGR isoforms and correlates with the induction of sesquiterpene cyclase gene expression, which peaks 24 hours after pathogen infection. This sequential regulation suggests HMGR2 plays a key role in the biosynthesis of defense-related sesquiterpene phytoalexins in pepper .

  • How does Capsicum annuum HMGR2 differ from other HMGR isoforms in plants?

    HMGR2 in C. annuum shows several distinct characteristics compared to other plant HMGR isoforms:

    FeatureHMGR2Other Plant HMGR Isoforms
    Expression patternPathogen-inducibleOften constitutive or developmentally regulated
    Response timeRapid (within 1 hour)Variable depending on isoform
    Primary functionDefense-related (phytoalexin production)Various (growth, development, basic metabolism)
    RegulationStress-responsiveOften regulated by developmental cues

    Unlike some constitutively expressed HMGR isoforms that function in basic metabolism and development, HMGR2 appears to be specialized for defense responses, similar to the wound-induced or elicitor-responsive HMGR isoforms found in other Solanaceae species like tomato and potato .

Advanced Research Methods and Applications

  • What is the recommended protocol for expressing and purifying recombinant Capsicum annuum HMGR2?

    For successful expression and purification of recombinant C. annuum HMGR2:

    1. Cloning Strategy:

      • Amplify the HMGR2 gene from cDNA obtained from pathogen-treated or methyl-JA-treated Capsicum leaves

      • For better solubility, use a truncated version (catalytic domain only) rather than full-length protein

      • Clone into an expression vector with a His-tag (e.g., pACYC-Duet vector)

    2. Expression Conditions:

      • Transform into E. coli BL21(DE3) cells

      • Grow at 37°C until mid-log phase

      • Induce with 1M IPTG (50 μl per 2 mL culture)

      • Continue growth at reduced temperature (18°C for 24h or 4°C for 72h)

    3. Purification Method:

      • Harvest cells by centrifugation (3,000×g)

      • Resuspend in cold extraction buffer (50 mM Tris, pH 7.5, 300 mM NaCl, 1.4 mM β-mercaptoethanol)

      • Disrupt cells by sonication (4 times 15s)

      • Clarify by centrifugation (14,000×g)

      • Purify using Ni-IDA resin for His-tagged protein

    The resulting protein can be found in both soluble and insoluble fractions, but functional studies indicate that the activity of truncated HMGR2 in the supernatant is significantly higher than that recovered from inclusion bodies .

  • How can the enzymatic activity of recombinant HMGR2 be measured accurately?

    To measure HMGR2 enzymatic activity, researchers typically use a combination of spectrophotometric and chromatographic methods:

    HPLC/MS Method:

    1. Prepare a 1 ml reaction mixture containing:

      • 2.5 mM K₂HPO₄

      • 5 mM KCl

      • 1 mM EDTA

      • 5 mM DTT

      • 1 mg/ml purified HMGR2

      • 3 mM NADPH (coenzyme)

      • 0.3 mM HMG-CoA (substrate)

      • pH 7.2

    2. Incubate at appropriate temperature (typically 30°C) for 30-60 minutes

    3. Terminate reaction by adding methanol or acid

    4. Analyze reaction products using HPLC coupled to MS

    5. Identify mevalonate formation at characteristic retention time (approximately 2.2 min) and m/z value of 131.0710

    Control reactions should be run without enzyme to establish baseline conditions. Kinetic parameters can be determined by varying substrate concentrations and measuring initial reaction rates .

  • What mechanisms regulate HMGR2 expression and activity in Capsicum annuum?

    HMGR2 in C. annuum is regulated at multiple levels:

    Transcriptional Regulation:

    • Rapidly induced by pathogen infection (within 1 hour)

    • Responsive to jasmonic acid (JA) treatment

    • Coordinated with other terpenoid pathway genes

    Post-transcriptional Regulation:

    • Potential mRNA stability control mechanisms

    • Tissue-specific expression patterns

    Post-translational Regulation:

    • Likely regulated by phosphorylation (as seen in other plant HMGRs)

    • May undergo degradation via the ubiquitin-proteasome pathway

    • Feedback inhibition by downstream mevalonate pathway products

    Environmental Factors Affecting Expression:

    • Pathogen infection (strongest inducer)

    • Jasmonic acid (JA) treatment

    • Spider mite infestation

    • Other abiotic stresses (similar to HMGRs in other plants)

  • How does HMGR2 overexpression impact the terpenoid metabolic network in plants?

    Overexpression of HMGR2 has significant impacts on plant terpenoid metabolism:

    1. Metabolic Consequences:

      • Increased production of mevalonate pathway intermediates

      • Enhanced synthesis of downstream terpenoids

      • Elevated levels of phytohormones (ABA, GA)

      • Increased carotenoid production (including lycopene)

    2. Pathway Crosstalk:

      • Affects expression levels of MVA-related genes

      • Also influences MEP pathway gene expression

      • Creates metabolic flux changes between pathways

    3. Quantifiable Changes (based on data from transgenic poplar studies):

      • 3-10 fold higher HMGR expression levels in transgenic lines

      • Significantly increased ABA and GA content

      • Enhanced carotene and lycopene production

    These results demonstrate that HMGR2 acts as a key regulatory enzyme not only affecting its own pathway but also influencing related pathways through metabolic crosstalk mechanisms. This makes it a potential target for metabolic engineering strategies aimed at enhancing valuable terpenoid production .

Research Applications and Future Directions

  • How does pathogen-induced HMGR2 contribute to the broader plant defense response in Capsicum species?

    HMGR2 plays a central role in the C. annuum defense response through several mechanisms:

    1. Coordinated Defense Activation:

      • HMGR2 is rapidly induced within 1 hour after pathogen exposure

      • Functions alongside farnesyl pyrophosphate synthase

      • Coordinates with sesquiterpene cyclase gene (strongly induced 24h after infection)

    2. Phytoalexin Production:

      • Facilitates the production of sesquiterpene phytoalexins

      • These compounds have direct antimicrobial activity against pathogens

      • Creates a chemical barrier to pathogen spread

    3. Defense Signaling Integration:

      • Responds to jasmonic acid (JA), a key defense hormone

      • Potentially interacts with other defense pathways

      • May influence systemic acquired resistance

    This coordinated and sequential regulation of HMGR2 along with other enzymes forms the foundation of the terpenoid-based chemical defense system in Capsicum species, particularly against fungal pathogens like Phytophthora capsici .

  • What are the functional differences between the catalytic domains of HMGR2 from different species?

    Comparative analysis of HMGR2 catalytic domains reveals important functional differences:

    FeatureClass I HMGRs (e.g., Human)Class II HMGRs (like C. annuum)
    Cofactor specificityNADPH exclusivelyVariable (NADH, NADPH, or both)
    Binding sitesSpecific NADPH bindingMore flexible cofactor binding
    Structural motifsSpecific arrangementDifferent arrangement of conserved motifs
    Inhibitor sensitivityHigh statin sensitivityVariable statin sensitivity
    Regulatory domainsSterol-sensing domainsDifferent regulatory elements

    These differences significantly affect their catalytic properties, regulation, and potential as targets for inhibitor development. The structural basis for these differences lies in the specific amino acid residues lining the cofactor binding pocket and substrate binding sites. Understanding these differences is crucial for developing species-specific inhibitors or enhancers of HMGR activity .

  • How do the kinetic parameters of recombinant HMGR2 compare to those of native enzyme?

    Kinetic studies reveal important differences between recombinant and native HMGR2:

    1. Activity Comparisons:

      • Recombinant truncated HMGR2 typically shows lower specific activity than native enzyme

      • Soluble recombinant HMGR2 has significantly higher activity than refolded protein from inclusion bodies

      • Catalytic efficiency (kcat/Km) is generally lower for recombinant versions

    2. Substrate Affinity:

      • Km values for HMG-CoA are often comparable between recombinant and native forms

      • Recombinant enzymes may show altered cofactor preferences

    3. Factors Affecting Activity:

      • Expression system (E. coli vs yeast vs insect cells)

      • Purification method and protein folding

      • Presence of terminal tags (His-tag, etc.)

      • Buffer conditions and assay parameters

    Researchers should be aware of these differences when using recombinant HMGR2 for inhibitor screening or other applications. Optimization of expression and purification conditions can help minimize these differences .

  • What strategies can be employed to enhance recombinant HMGR2 solubility and yield?

    Several approaches can improve recombinant HMGR2 production:

    1. Construct Optimization:

      • Express truncated catalytic domain (removing transmembrane regions)

      • Optimize codon usage for expression host

      • Use solubility-enhancing fusion partners (MBP, SUMO, etc.)

    2. Expression Conditions:

      • Lower induction temperature (18°C or 4°C)

      • Reduce IPTG concentration (50 μl of 1M IPTG per 2 mL culture)

      • Use specialized E. coli strains (Rosetta, Arctic Express)

      • Extended expression time at lower temperatures (24-72h)

    3. Purification Strategies:

      • Use gentle cell lysis methods

      • Include stabilizing agents in buffers (glycerol, reducing agents)

      • Purify from soluble fraction rather than refolding from inclusion bodies

      • Optimize imidazole concentration in elution buffers

    4. Alternative Expression Systems:

      • Consider yeast or insect cell expression for better folding

      • Cell-free protein synthesis systems

    These approaches have been shown to significantly improve the yield of active HMGR2 protein in various research settings .

  • How can recombinant HMGR2 be used to study the metabolic crosstalk between MVA and MEP pathways?

    Recombinant HMGR2 offers several approaches to investigate pathway crosstalk:

    1. In vitro Reconstitution Studies:

      • Combine purified recombinant HMGR2 with enzymes from both pathways

      • Trace metabolite flow using labeled precursors

      • Identify key regulatory nodes and bottlenecks

    2. Metabolic Engineering:

      • Overexpress HMGR2 in model plants or cell cultures

      • Analyze changes in gene expression across both pathways

      • Measure metabolite profiles to identify pathway interactions

    3. Inhibitor Studies:

      • Use pathway-specific inhibitors alongside recombinant HMGR2

      • Determine how inhibition of one pathway affects the other

      • Identify compensatory mechanisms

    Research with transgenic poplar overexpressing HMGR has already demonstrated that HMGR overexpression affects not only MVA pathway genes but also MEP pathway gene expression, suggesting significant crosstalk between these pathways. Recombinant HMGR2 provides a tool to dissect these interactions mechanistically .

  • What methods are most effective for analyzing the contribution of HMGR2 to terpenoid profiles in Capsicum?

    Several complementary approaches provide a comprehensive view of HMGR2's role:

    1. Genetic Approaches:

      • HMGR2 overexpression or silencing in Capsicum

      • CRISPR/Cas9-mediated gene editing

      • Promoter analysis to identify regulatory elements

    2. Analytical Methods:

      • HPLC-MS/MS for terpenoid profiling

      • GC-MS for volatile terpenoid analysis

      • Targeted metabolomics focusing on pathway intermediates

      • Untargeted metabolomics for broader metabolic impacts

    3. Expression Analysis:

      • qRT-PCR for transcript quantification

      • RNA-seq for pathway-wide expression changes

      • Protein immunoblotting for HMGR2 protein levels

    4. Biochemical Approaches:

      • In vitro enzyme assays with recombinant HMGR2

      • Feeding experiments with labeled precursors

      • Enzyme inhibition studies

    These methods can be combined to create a comprehensive understanding of how HMGR2 contributes to terpenoid biosynthesis under various conditions, particularly during pathogen defense responses .

  • How do cofactor preferences of HMGR2 impact experimental design and application?

    Understanding HMGR2 cofactor preferences is crucial for research applications:

    1. Experimental Considerations:

      • Assay design must account for optimal cofactor (NADPH vs. NADH)

      • Buffer conditions may need optimization for cofactor stability

      • Kinetic parameters should be determined for each potential cofactor

    2. Mechanistic Implications:

      • Cofactor preference reflects evolutionary adaptations

      • May indicate cellular compartmentalization or metabolism connections

      • Influences reaction efficiency under different physiological conditions

    3. Practical Applications:

      • For recombinant protein production, ensure sufficient cofactor supply

      • In metabolic engineering, consider cofactor availability in target tissues

      • When designing inhibitors, account for cofactor binding interactions

    Class II HMGRs (including those from plants like C. annuum) display a wide range of cofactor specificities, with some using NADH exclusively, others using NADPH, and some capable of using both. This versatility must be considered when designing experiments or engineering applications involving HMGR2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.