Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Capsicum Annuum Beta-Carotene Hydroxylase 2

Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2) represents a bioengineered version of a native enzyme found in bell peppers (Capsicum annuum). This enzyme belongs to the class of diiron-containing membrane proteins that catalyze the hydroxylation of carotenoids, playing a crucial role in the biosynthesis of xanthophylls - oxygenated carotenoids essential for various plant functions . The recombinant form is produced by expressing the CA2 gene in heterologous host systems, primarily Escherichia coli, which enables researchers to obtain substantial quantities of purified protein for experimental and analytical purposes.

The importance of CA2 extends beyond its enzymatic function in the carotenoid pathway. As a key component in the biosynthesis of zeaxanthin and indirectly involved in capsanthin production, this enzyme influences the nutritional profile and visual characteristics of pepper fruits. The vibrant colors of bell peppers, particularly the transition from green to red during ripening, are largely determined by carotenoid accumulation, which is regulated in part by the activity of enzymes like CA2 .

The study of recombinant CA2 has significantly advanced our understanding of carotenoid metabolism in plants. By producing this enzyme in a recombinant system, researchers can investigate its catalytic properties, substrate specificity, and structure-function relationships without the complexities associated with extracting the native protein from plant tissues. This approach has facilitated detailed biochemical characterization and provided insights into the mechanisms by which CA2 contributes to carotenoid diversity in nature.

Gene Information and Genomic Context

The CA2 gene encoding Beta-carotene hydroxylase 2 is identified by several designations in genomic databases, providing important context for understanding its evolutionary relationships and functional significance:

ParameterInformation
Gene NameCA2
SynonymsLOC107873401, T459_16578, Beta-carotene hydroxylase 2, chloroplastic
UniProt IDO49814

Research has revealed that pepper plants contain multiple β-carotene hydroxylase genes located on different chromosomes. Studies indicate that two hydroxylase genes, designated as CrtZchr03 and CrtZchr06, are present in pepper on chromosomes 3 and 6 . These genes may have overlapping but distinct functions in carotenoid metabolism, with potential implications for fruit pigmentation and nutritional quality.

Deletion of the CrtZchr03 gene has been shown to result in increased β-carotene accumulation, highlighting the functional importance of these genes in determining carotenoid profiles . The presence of multiple isoforms suggests functional specialization that may be related to tissue-specific expression patterns, developmental regulation, or differential responses to environmental factors.

The genomic organization of these hydroxylase genes and their evolutionary relationships provide insights into the diversification of carotenoid biosynthetic pathways in Capsicum species and other plants. This information is valuable for comparative genomic analyses and for developing targeted genetic interventions to modulate carotenoid accumulation.

Role in Carotenoid Biosynthesis

Beta-carotene hydroxylase 2 catalyzes a crucial step in the xanthophyll biosynthetic pathway, specifically the conversion of β-carotene to zeaxanthin through a two-step hydroxylation process . In the first step, β-carotene is hydroxylated at the C-3 position of one β-ionone ring to form β-cryptoxanthin. Subsequently, a second hydroxylation at the C-3' position of the other β-ionone ring yields zeaxanthin, a dihydroxy carotenoid.

Zeaxanthin serves multiple functions in plants, including photoprotection by participating in the xanthophyll cycle, which dissipates excess light energy and prevents photooxidative damage to photosynthetic apparatus. Additionally, zeaxanthin acts as a precursor for the synthesis of other important carotenoids, including violaxanthin and neoxanthin, which can be further metabolized to form plant hormones such as abscisic acid.

In Capsicum annuum, Beta-carotene hydroxylase 2 also contributes indirectly to the biosynthesis of capsanthin, the primary red pigment that accumulates during fruit ripening. Research indicates that the transcriptional expression of β-carotene hydroxylase (CrtZ) is directly correlated with the transcriptional level of capsanthin/capsorubin synthase (CCS) in peppers . Overexpression of heterologous CrtZ has been shown to enhance the expression of endogenous CrtZ and CCS genes, promoting capsanthin production . This relationship highlights the interconnected nature of carotenoid biosynthetic pathways and the importance of coordinated gene expression for proper pigment accumulation.

The enzymatic activity of CA2 thus plays a pivotal role in determining the carotenoid composition of pepper fruits, influencing both their nutritional value and visual characteristics. Understanding these biochemical pathways provides opportunities for targeted interventions to enhance desirable carotenoid accumulation in crops.

Promiscuous Enzymatic Activity

Recent research has revealed that β-carotene hydroxylases, including enzymes similar to CA2, can exhibit promiscuous activity with substrates beyond their primary ones. According to studies, the β-carotene hydroxylase CrtZ, a diiron-containing membrane protein similar to CA2, can catalyze the formation of rare carotenoids with 6-hydroxy-3-keto-ε-end groups by using epoxycarotenoids such as antheraxanthin or violaxanthin as substrates .

This promiscuous activity leads to the formation of uncommon carotenoid structures found in specific organisms. For example, carotenoids with 6-hydroxy-3-keto-ε-end groups, such as piprixanthin, vitixanthin, or cochloxanthin, have been identified in manakin birds and certain plants . These rare carotenoids exhibit high antioxidant activity and may have unique biological properties.

The reaction mechanism for this promiscuous activity is proposed to be similar to that of rhodoxanthin biosynthetic enzymes . This discovery expands our understanding of how structurally diverse carotenoids arise in nature and suggests that the catalytic versatility of enzymes like CA2 may be greater than previously recognized. Such findings contribute to our knowledge of carotenoid diversity and open up possibilities for the biotechnological production of rare carotenoids with potentially valuable properties.

The ability of β-carotene hydroxylases to accept multiple substrates and catalyze different types of reactions represents an important aspect of their biochemical characterization. Further investigation of this promiscuous activity could lead to the discovery of novel carotenoid structures and provide insights into the evolutionary processes that have shaped carotenoid biosynthetic pathways.

Impact on Pepper Fruit Quality and Nutrition

The activity of Beta-carotene hydroxylase 2 and related enzymes significantly influences the carotenoid profile of pepper fruits, which in turn affects both their color and nutritional value. Capsicum fruits are rich in various bioactive compounds, including capsaicinoids, carotenoids, flavonoids, vitamins, and minerals . The composition and quantity of these compounds vary according to genetic factors, environmental conditions, and developmental stage.

Carotenoids like zeaxanthin and capsanthin, whose biosynthesis is influenced by CA2 activity, contribute to the nutritional value of peppers due to their antioxidant properties and potential health benefits. These compounds are part of the complex biochemical profile of Capsicum annuum, which also includes significant levels of vitamins (particularly vitamin C), minerals, and other phytonutrients .

The modulation of CA2 expression or activity, either through conventional breeding or genetic engineering approaches, represents a potential strategy for enhancing the nutritional quality and visual appeal of pepper fruits. By understanding the regulatory mechanisms governing CA2 expression and the factors affecting its enzymatic activity, researchers can develop targeted approaches for optimizing carotenoid accumulation in Capsicum and other crops.

Expression Systems and Methodologies

Recombinant Capsicum annuum Beta-carotene hydroxylase 2 is primarily produced in Escherichia coli expression systems. The process typically involves cloning the coding sequence for the mature protein (amino acids 100-316) into an appropriate expression vector, often incorporating an N-terminal histidine tag to facilitate subsequent purification . The recombinant plasmid is then transformed into a suitable E. coli strain optimized for protein expression.

Expression conditions, including temperature, induction method, and duration, are carefully optimized to maximize protein yield while maintaining proper folding and activity. Since CA2 is naturally a membrane-associated protein, special considerations may be necessary to ensure proper folding and solubility of the recombinant protein. This might include the use of specific E. coli strains designed for membrane protein expression, optimization of growth media, or the addition of solubilizing agents.

Codon optimization has been shown to significantly enhance the expression of carotenoid biosynthetic enzymes in heterologous hosts. For example, optimizing the codons of CrtZ, CrtY, and CrtI genes has resulted in a 10-fold increase in zeaxanthin yield in engineered E. coli . This approach involves adjusting the codon usage of the gene to match the preferences of the host organism, thereby improving translation efficiency and protein production.

Recent advances in expression technology include the use of viral vectors for high-level production of carotenoid biosynthetic enzymes. Research has demonstrated that geminivirus-based expression systems can be employed for rapid and efficient synthesis of carotenoids by optimizing the expression of key enzymes in the pathway . These approaches take advantage of the high replicative capacity of viral vectors to achieve substantial protein production in relatively short timeframes.

Purification and Quality Control

The purification of recombinant CA2 typically involves a multi-step process designed to isolate the protein with high purity while preserving its enzymatic activity. Key steps in the purification process often include:

  1. Cell lysis under conditions that solubilize the recombinant protein while minimizing proteolytic degradation

  2. Immobilized metal affinity chromatography (IMAC) utilizing the N-terminal histidine tag to selectively capture the recombinant protein

  3. Additional chromatographic steps if necessary to achieve the desired level of purity

  4. Quality control analysis using SDS-PAGE to verify protein purity (typically >90%)

  5. Functional assays to confirm enzymatic activity and substrate specificity

The purified protein is often lyophilized (freeze-dried) for long-term storage and stability . This process involves freezing the protein solution and then removing the water by sublimation under vacuum conditions, resulting in a stable powder form of the protein. The lyophilized protein is typically stored in a buffer containing Tris/PBS and 6% trehalose at pH 8.0, which helps maintain structural integrity and activity during storage .

Quality control measures typically include verification of protein identity by mass spectrometry, assessment of purity by SDS-PAGE, and confirmation of enzymatic activity through appropriate biochemical assays. These steps ensure that the recombinant protein meets the required specifications for research applications and provides reliable results in experimental settings.

Genetic Engineering for Enhanced Carotenoid Production

Recombinant Beta-carotene hydroxylase 2 and its corresponding gene have significant applications in metabolic engineering for enhanced carotenoid production. Several examples highlight the versatility of β-carotene hydroxylase genes as tools for biotechnological applications:

  1. Modulation of carotenoid profiles through gene manipulation: Deletion of the CrtZchr03 gene in pepper has been shown to result in increased β-carotene accumulation, demonstrating the potential to alter carotenoid compositions through targeted genetic interventions .

  2. Co-expression strategies for valuable carotenoids: Co-transformation of genes responsible for β-carotene biosynthesis, including 4,4′-ketolase (CrtW) and β-carotene 3,3′-hydroxylase (CrtZ), has been employed to engineer transgenic organisms capable of producing astaxanthin, a carotenoid with high commercial value due to its antioxidant properties and applications in aquaculture .

  3. Enhanced zeaxanthin production: Optimization of codons for carotenoid biosynthetic genes, including CrtZ, has led to significant improvements in zeaxanthin production in engineered E. coli, resulting in a 10-fold increase in yield . This approach demonstrates the potential for substantial enhancement of carotenoid production through genetic optimization.

  4. Improved stress tolerance in plants: Expression of heterologous β-carotene hydroxylase (CrtZ) in tobacco leaves has been shown to enhance protection against high light and UV radiation, suggesting potential applications in improving crop stress tolerance . This finding highlights the broader agricultural implications of carotenoid engineering beyond nutritional enhancement.

  5. Rapid production systems: Recent research has demonstrated that geminivirus-based expression systems can be employed for high-efficiency synthesis of carotenoids, including capsanthin, by optimizing the expression of key enzymes in the pathway . This approach takes advantage of the high replicative capacity of viral vectors to achieve substantial carotenoid production in shorter timeframes.

These examples illustrate the diverse applications of β-carotene hydroxylase genes in metabolic engineering and their potential to contribute to the production of high-value carotenoids for various industrial, nutritional, and agricultural purposes.

Development of Novel Biotechnological Applications

Research on Beta-carotene hydroxylase 2 and related enzymes has led to various innovative biotechnological applications. The search results suggest several promising directions:

  1. Engineering of carotenoid biosynthetic pathways: By manipulating the expression or activity of CA2 and other enzymes in the pathway, researchers can redirect metabolic flux toward specific carotenoids of interest. This approach has been used to enhance the production of zeaxanthin, astaxanthin, and other high-value carotenoids in various host organisms .

  2. Creation of fusion enzymes: Studies have shown that fusion enzymes, such as CrtZ-CrtW, can be designed to optimize the production of specific carotenoids by channeling intermediates between enzymatic steps . This strategy enhances the efficiency of multi-step biosynthetic pathways by bringing sequential enzymes into close proximity.

  3. Development of rapid expression systems: Viral vectors, such as geminivirus-based systems, have been employed for the fast and high-efficiency synthesis of carotenoids in plants . This approach takes advantage of the high replicative capacity of viral genomes to achieve substantial protein production and metabolite accumulation in relatively short timeframes.

  4. Improvement of plant stress tolerance: The expression of β-carotene hydroxylase genes in transgenic plants has been shown to enhance protection against high light and UV radiation . This finding suggests potential applications in developing crops with improved resilience to environmental stresses, an increasingly important consideration in the context of climate change.

  5. Enhancement of nutritional quality: By understanding and manipulating the carotenoid biosynthetic pathway, researchers can develop strategies to enhance the nutritional value of crops. This includes increasing the content of specific carotenoids with health-promoting properties, such as zeaxanthin, which is associated with eye health benefits.

These applications demonstrate the potential of research on Beta-carotene hydroxylase 2 to contribute to advancements in fields ranging from nutrient fortification to natural product synthesis and crop improvement.

Reconstitution and Handling Guidelines

For optimal results when working with recombinant CA2, specific reconstitution and handling procedures are recommended:

  1. Centrifuge the vial briefly before opening to bring the contents to the bottom

  2. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being a commonly used concentration)

  4. Aliquot the reconstituted protein to minimize freeze-thaw cycles

  5. When handling the protein, maintain appropriate temperature conditions to preserve activity

These guidelines help ensure that the recombinant protein retains its structural integrity and enzymatic activity, providing reliable results in experimental applications. Proper handling is particularly important for membrane-associated proteins like CA2, which may be more susceptible to denaturation than soluble proteins due to their hydrophobic regions.

When using the recombinant protein for enzymatic assays or other functional studies, it is advisable to optimize reaction conditions, including buffer composition, pH, temperature, and the presence of cofactors or activators, to achieve maximum activity. These parameters may vary depending on the specific application and should be determined empirically for each experimental system.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your product.
Synonyms
CA2; LOC107873401; T459_16578; Beta-carotene hydroxylase 2, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
100-316
Protein Length
Full Length of Mature Protein
Species
Capsicum annuum (Bell pepper)
Target Names
CA2
Target Protein Sequence
AEKLARKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGEVPFSEMFGTFALSVG AAVGMEFWARWAHKALWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIALLDYGFFH KGLIPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKF NGVPYGLFLGPKELEEVGGLEELEKEVNRRTRYIKGS
Uniprot No.

Target Background

Function
Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. This enzyme exhibits specificity for beta-ring hydroxylations of beta-carotene, producing beta-cryptoxanthin and zeaxanthin. It utilizes ferredoxin as an electron donor.
Database Links

KEGG: ag:CAA70888

UniGene: Can.118

Protein Families
Sterol desaturase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Capsicum annuum Beta-carotene hydroxylase 2 (CA2) and what is its primary function?

Beta-carotene hydroxylase 2 (CA2) from Capsicum annuum (bell pepper) is a key enzyme in the carotenoid biosynthetic pathway that catalyzes the hydroxylation of β-carotene to produce β-cryptoxanthin and subsequently zeaxanthin. This enzyme belongs to the class of oxidoreductases and is localized in chloroplasts. The protein plays a crucial role in xanthophyll biosynthesis, which is essential for various physiological processes including photoprotection and hormone synthesis. CA2 contains signature His-containing motifs (HXXXXH and HXXHH) that are conserved across species and are essential for enzymatic activity . The recombinant form of this protein can be expressed with an N-terminal His-tag in E. coli expression systems, making it suitable for in vitro studies of carotenoid metabolism .

How does CA2 contribute to carotenoid accumulation in Capsicum fruits?

CA2 plays a significant role in determining the carotenoid profile of Capsicum annuum fruits. The enzyme is involved in the conversion of β-carotene to zeaxanthin, which serves as a precursor for the synthesis of red carotenoids like capsanthin and capsorubin in red pepper fruits . Research on orange-colored Capsicum cultivars has revealed unique carotenoid profiles associated with distinct patterns of transcription of carotenogenic enzymes, including CA2 (referred to as CrtZ-2 in some studies) .

Studies have shown that the expression levels of carotenogenic genes, including those encoding β-carotene hydroxylases, directly influence carotenoid composition in pepper fruits. In orange-colored cultivars, differential expression of CA2 contributes to the accumulation of specific carotenoid compounds. For example, in cultivars like 'Fogo,' mutations in downstream enzymes like capsanthin-capsorubin synthase (CCS) prevent the conversion of zeaxanthin to red pigments, resulting in orange coloration despite normal CA2 function . In contrast, cultivars like 'Orange Grande' and 'Oriole' lack CCS transcripts entirely, leading to an accumulation of β-carotene and other precursors that CA2 would normally metabolize .

What experimental approaches are recommended for assaying CA2 enzymatic activity?

For assaying recombinant CA2 enzymatic activity, researchers should consider the following methodology:

  • Protein Preparation: Reconstitute lyophilized recombinant CA2 protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 5-50% for long-term storage. Avoid repeated freeze-thaw cycles to maintain enzymatic activity .

  • Substrate Preparation: Prepare β-carotene substrate in a suitable solvent system (typically a mixture of acetone and buffer) that maintains substrate solubility while providing an appropriate environment for the enzyme.

  • Reaction Conditions: Conduct enzymatic assays in a buffer system that mimics the chloroplastic environment (pH ~7.5-8.0). Include appropriate cofactors such as Fe²⁺ and ascorbate, which are typically required for non-heme iron-dependent hydroxylases.

  • Activity Detection: Monitor the conversion of β-carotene to β-cryptoxanthin and zeaxanthin using high-performance liquid chromatography (HPLC) with photodiode array detection. The characteristic absorption spectra of carotenoids (typically maxima between 400-500 nm) allow for specific identification and quantification of substrates and products .

  • Kinetic Analysis: Determine enzyme kinetic parameters (Km, Vmax) by varying substrate concentrations and measuring initial reaction rates. Plot the data using Lineweaver-Burk or Eadie-Hofstee transformations to derive kinetic constants.

This methodology enables precise characterization of CA2 catalytic properties and allows comparison with other β-carotene hydroxylases from different species or mutant variants.

How do mutations in conserved histidine motifs affect CA2 catalytic function?

The catalytic activity of β-carotene hydroxylases, including CA2, critically depends on the integrity of conserved histidine-containing motifs (HXXXXH and HXXHH). These motifs are essential for coordinating iron cofactors that participate in the hydroxylation reaction . Research on related BCH enzymes has demonstrated that site-directed mutagenesis altering these conserved histidine residues results in complete loss of enzymatic activity .

Specifically, the histidine residues in these motifs are involved in:

  • Cofactor Binding: Coordination of the non-heme iron required for the hydroxylation reaction

  • Substrate Positioning: Proper orientation of the β-carotene substrate in the active site

  • Oxygen Activation: Facilitation of oxygen binding and activation for the hydroxylation reaction

Mutations affecting these residues can disrupt the enzyme's ability to coordinate iron, bind substrate, or activate oxygen, resulting in diminished or abolished hydroxylase activity. This structural feature is shared among carotenoid hydroxylases across plant species, highlighting its evolutionary conservation and functional significance .

Experimental approaches using site-directed mutagenesis to alter these conserved histidine residues, followed by in vitro activity assays with the recombinant protein, would provide valuable insights into the structure-function relationships of CA2 and its catalytic mechanism.

What is the relationship between CA2 expression and carotenoid profiles in different Capsicum cultivars?

Research on orange-colored Capsicum annuum cultivars has revealed complex relationships between CA2 (CrtZ-2) expression and carotenoid accumulation patterns. Studies have identified three distinct mechanisms leading to orange fruit coloration:

  • Mutation in downstream enzymes: In cultivars like 'Fogo,' a mutant allele of capsanthin-capsorubin synthase (ccs-3) results in premature termination of protein synthesis. Despite normal CA2 expression and β-carotene hydroxylation, the absence of functional CCS prevents conversion to red pigments, leading to accumulation of orange carotenoids .

  • Transcriptional regulation: In cultivars like 'Orange Grande' and 'Oriole,' no transcripts for CCS are detected despite the presence of wild-type alleles for all carotenogenic enzymes, including CA2. This transcriptional regulation prevents red pigment formation despite normal CA2 function .

  • Post-transcriptional regulation: In the 'Canary' cultivar, transcripts for all carotenogenic enzymes (including wild-type CA2 and CCS) are detected, but no CCS protein accumulates and no red carotenoids are synthesized, suggesting post-transcriptional control .

The following table summarizes the relationship between CA2 expression, other carotenogenic enzymes, and carotenoid profiles in orange Capsicum cultivars:

CultivarCA2 Gene StatusCA2 TranscriptCA2 ProteinCCS StatusPredominant Carotenoids
FogoWild-typePresentFunctionalMutant (ccs-3)β-carotene, zeaxanthin
Orange GrandeWild-typePresentFunctionalWild-type gene, no transcriptβ-carotene, zeaxanthin
OrioleWild-typePresentFunctionalWild-type gene, no transcriptβ-carotene, zeaxanthin
CanaryWild-typePresentFunctionalWild-type transcript, no proteinβ-carotene, zeaxanthin

These findings highlight the complex regulatory network controlling carotenoid biosynthesis in Capsicum, where CA2 function is necessary but not sufficient for determining fruit color, which depends on the coordinated expression and activity of multiple enzymes in the pathway .

How can recombinant CA2 be used for in vitro reconstitution of carotenoid biosynthetic pathways?

Recombinant CA2 protein provides a valuable tool for in vitro reconstitution of carotenoid biosynthetic pathways, enabling detailed mechanistic studies and metabolic engineering applications. The methodological approach for such reconstitution includes:

  • Enzymatic Cascade Assembly: Combine purified recombinant CA2 with other carotenogenic enzymes (phytoene synthase, desaturases, isomerases, cyclases) in a sequential reaction system to reconstruct the complete pathway from early precursors to xanthophylls.

  • Membrane Mimetic Systems: Since CA2 is naturally membrane-associated, incorporate the enzyme into liposomes or nanodiscs to provide a membrane-like environment that facilitates proper protein folding and substrate accessibility.

  • Cofactor Supplementation: Include essential cofactors such as Fe²⁺, molecular oxygen, and reducing agents (ferredoxin/ferredoxin reductase or artificial electron donors) to support hydroxylase activity.

  • Substrate Feeding: Supply β-carotene as substrate, either synthesized in situ by upstream enzymes or added directly to the reaction mixture in an appropriate solvent system.

  • Product Analysis: Monitor reaction progress using HPLC-PDA or LC-MS/MS to identify and quantify intermediate and final products of the pathway.

This in vitro reconstitution approach offers several advantages:

  • Enables study of enzyme kinetics without cellular constraints

  • Allows manipulation of reaction conditions to optimize product yields

  • Facilitates investigation of rate-limiting steps in the pathway

  • Provides a platform for testing enzyme variants or engineered proteins

  • Supports discovery of novel carotenoid derivatives through precursor feeding

The recombinant CA2 protein with His-tag is particularly suitable for such applications due to its ease of purification and stability when properly handled and stored.

What roles do carotenoid cleavage products of CA2 substrates play in plant development?

Carotenoids processed by CA2, particularly zeaxanthin, serve as precursors for biologically active cleavage products that play crucial roles in plant development and environmental responses. Carotenoid cleavage dioxygenases (CCDs) catalyze the oxidative cleavage of carotenoids, generating various apocarotenoids with diverse functions .

Key developmental roles of these cleavage products include:

  • Hormone Biosynthesis: Zeaxanthin is a precursor in the biosynthetic pathway leading to abscisic acid (ABA), a phytohormone regulating seed dormancy, stomatal closure, and stress responses . The epoxidation of zeaxanthin by zeaxanthin epoxidase (ZEP) represents the first step in this pathway.

  • Strigolactone Production: CCDs, particularly CCD7 and CCD8, cleave carotenoids to produce strigolactones, hormones that inhibit shoot branching and promote symbiotic relationships with beneficial soil microorganisms .

  • Symbiotic Signaling: In leguminous plants, apocarotenoids derived from zeaxanthin and other xanthophylls function as signals during nodulation and mycorrhizal symbiosis. Studies in soybean have demonstrated that interference with BCH expression impairs nodule development and nitrogen fixation, suggesting a role for CA2-like enzymes in symbiotic processes .

  • Flavor and Aroma Compounds: Some carotenoid cleavage products contribute to plant-specific flavors and aromas, which may function in plant-environment interactions.

Research in soybean has shown that despite the absence of detectable carotenoids in root nodules, the expression of BCH genes is essential for nodule development, suggesting that the cleavage products of carotenoids, rather than the carotenoids themselves, may be the biologically active compounds in this context .

What are the optimal storage and handling conditions for recombinant CA2 protein?

For optimal preservation of recombinant CA2 enzymatic activity, researchers should adhere to the following storage and handling protocols:

  • Initial Processing: Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material is at the bottom of the container .

  • Reconstitution: Dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Ensure complete dissolution by gentle mixing rather than vigorous agitation, which could denature the protein .

  • Storage Buffer: The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

  • Aliquoting: After reconstitution, add glycerol to a final concentration of 5-50% (with 50% being the recommended standard) and divide into small aliquots to minimize freeze-thaw cycles .

  • Temperature Conditions: Store working aliquots at 4°C for up to one week. For long-term storage, maintain aliquots at -20°C or preferably -80°C .

  • Freeze-Thaw Management: Repeated freezing and thawing significantly reduces enzymatic activity and should be strictly avoided. Each aliquot should ideally be thawed only once before use .

  • Working Conditions: When conducting experiments, keep the protein on ice when not in use, and use temperature-controlled reaction vessels to maintain optimal conditions for enzymatic activity.

Adherence to these guidelines ensures maximum retention of enzymatic activity and reproducibility of experimental results when working with recombinant CA2 protein.

How can transcriptomic analysis be applied to study CA2 regulation during fruit development?

Transcriptomic analysis provides powerful tools for investigating CA2 regulation during Capsicum fruit development. A comprehensive experimental approach would include:

  • Developmental Time-Course Sampling: Collect fruit samples at well-defined developmental stages from fruit set to full ripening, ensuring biological replicates for statistical robustness.

  • RNA-Seq Methodology: Extract high-quality total RNA and prepare sequencing libraries using standard protocols. Perform deep sequencing (>30 million reads per sample) to ensure detection of low-abundance transcripts.

  • Differential Expression Analysis: Apply statistical methods to identify differentially expressed genes (DEGs) across developmental stages, with particular focus on CA2 and other carotenogenic genes.

  • Co-Expression Network Analysis: Construct gene co-expression networks to identify transcriptional modules associated with CA2 expression, potentially revealing transcription factors and regulatory elements controlling carotenoid metabolism.

  • Integration with Metabolomic Data: Correlate CA2 transcript levels with carotenoid profiles measured by HPLC or LC-MS/MS to establish quantitative relationships between gene expression and metabolite accumulation.

Research on orange-colored Capsicum cultivars has demonstrated the value of this approach, revealing distinct patterns of CA2 (CrtZ-2) expression correlated with specific carotenoid profiles . The analysis should account for cultivar-specific differences, as transcriptional patterns of carotenogenic genes can vary significantly between varieties .

For accurate quantification of CA2 transcripts, researchers should design specific primers that account for potential sequence similarities with other BCH genes, as demonstrated in studies of soybean BCH genes . Real-time RT-PCR validation of RNA-Seq data is essential for confirming expression patterns observed in the transcriptomic analysis.

What strategies can be employed to study subcellular localization of CA2 in plant cells?

Determining the precise subcellular localization of CA2 is critical for understanding its function in the context of carotenoid biosynthesis. Multiple complementary approaches can be employed:

  • Fluorescent Protein Fusion: Generate constructs expressing CA2 fused to fluorescent proteins (e.g., GFP, YFP) for transient expression and visualization in plant protoplasts or stable transformation of model plants. This approach allows real-time observation of protein localization in living cells .

  • Immunogold Electron Microscopy: Develop specific antibodies against CA2 for immunogold labeling followed by electron microscopy to achieve high-resolution localization at the ultrastructural level. This technique can precisely identify the association of CA2 with specific chloroplast compartments (envelope, thylakoid membranes, or plastoglobuli) .

  • Subcellular Fractionation: Isolate intact chloroplasts from plant tissue expressing CA2, followed by sub-organellar fractionation to separate envelope membranes, thylakoids, and stroma. Western blot analysis of these fractions can biochemically confirm the membrane association of CA2.

  • In silico Prediction: Use bioinformatic tools to predict chloroplast transit peptides and transmembrane domains in the CA2 sequence, providing theoretical support for experimental observations.

  • Bimolecular Fluorescence Complementation (BiFC): Employ BiFC to study protein-protein interactions between CA2 and other carotenogenic enzymes within their native subcellular environment, providing insights into the formation of potential metabolic complexes.

Studies of BCH proteins in other plants have shown that most BCHs possess plastid transit sequences and localize to chloroplasts or other plastids, but there are exceptions. For example, some BCH isoforms in soybean (GmBCH1) appear to be cytosolic, while others (GmBCH2 and GmBCH3) are plastid-localized . Such differential localization may reflect specialized roles in carotenoid metabolism across different cellular compartments.

How can researchers distinguish between the activities of different β-carotene hydroxylase isoforms?

Distinguishing between multiple β-carotene hydroxylase isoforms presents significant experimental challenges. Researchers can employ the following strategies to differentiate between CA2 and other BCH isoforms:

  • Enzyme-Specific Kinetic Analysis: Determine substrate specificity profiles and kinetic parameters (Km, Vmax, kcat) for each BCH isoform using purified recombinant proteins. Different isoforms may exhibit preferences for specific carotenoid substrates or display distinct reaction rates.

  • Inhibitor Sensitivity Profiling: Test the sensitivity of different BCH isoforms to various inhibitors or reaction conditions. Differential responses can serve as biochemical fingerprints for distinguishing enzyme activities.

  • Gene-Specific Silencing: Employ RNA interference (RNAi) or CRISPR-Cas9 gene editing to selectively suppress individual BCH genes and observe the resulting effects on carotenoid profiles. This approach has been successfully used in soybean to study BCH function in nodulation .

  • Isoform-Specific Antibodies: Develop antibodies targeting unique epitopes in different BCH isoforms for specific immunodetection, allowing quantification of individual proteins in complex samples.

  • Expression Pattern Analysis: Analyze tissue-specific and developmental expression patterns of different BCH genes using real-time RT-PCR with isoform-specific primers. Research in soybeans has shown that different BCH genes have distinct expression profiles across tissues and developmental stages .

  • Subcellular Localization: Determine the subcellular localization of different BCH isoforms using fluorescent protein fusions or immunolocalization, as different cellular compartments may contain distinct isoforms with specialized functions .

Researchers studying BCH genes in soybean faced similar challenges in distinguishing between highly homologous isoforms (e.g., GmBCH1 and GmBCH3), requiring careful design of gene-specific primers and validation of their specificity . Such approaches can be adapted for studying CA2 and other BCH isoforms in Capsicum annuum.

What approaches can resolve contradictory data on carotenoid pathway regulation in Capsicum?

Research on carotenoid biosynthesis in Capsicum has revealed apparent contradictions in the relationship between gene expression, enzyme activity, and carotenoid accumulation. To resolve these discrepancies, researchers should consider multifaceted approaches:

  • Multi-Omics Integration: Combine transcriptomic, proteomic, and metabolomic analyses to create a comprehensive picture of carotenoid pathway regulation. This integration can reveal post-transcriptional and post-translational regulatory mechanisms that may explain discrepancies between transcript levels and metabolite accumulation .

  • Protein Stability and Turnover Studies: Investigate protein stability and turnover rates using pulse-chase experiments or protein degradation inhibitors. In some orange Capsicum cultivars, transcripts for wild-type carotenogenic enzymes are detected, but the corresponding proteins do not accumulate, suggesting post-transcriptional regulation .

  • Genetic Polymorphism Analysis: Sequence the coding and regulatory regions of carotenogenic genes from cultivars with contradictory phenotypes to identify subtle mutations that may affect enzyme function or regulation but are not apparent at the transcript level.

  • Enzyme Activity Assays: Perform direct enzymatic assays on protein extracts from different cultivars to determine whether transcribed genes produce functionally active enzymes. Discrepancies between transcript levels and enzyme activities may indicate translational or post-translational regulation.

  • Analysis of Non-Coding RNAs: Investigate the role of microRNAs and other non-coding RNAs in post-transcriptional regulation of carotenogenic genes, which could explain cases where transcript detection does not correlate with protein accumulation.

  • Carotenoid Sequestration and Turnover: Examine mechanisms of carotenoid sequestration, storage, and degradation, as differences in these processes can lead to contradictory relationships between enzyme activity and carotenoid accumulation.

Studies of orange-colored Capsicum cultivars have revealed that non-structural genes may control color development independently of structural genes in the carotenoid pathway , highlighting the complexity of regulatory mechanisms that must be considered when interpreting contradictory data.

How might CA2 be engineered to enhance carotenoid production in crop plants?

Engineered modifications of CA2 offer promising strategies for enhancing carotenoid production in crop plants. Based on current knowledge of carotenoid biosynthesis, the following approaches show particular promise:

  • Protein Engineering for Enhanced Catalytic Efficiency: Utilize directed evolution or rational design to modify the catalytic domains of CA2, potentially enhancing its affinity for β-carotene or increasing its catalytic rate. Focus modifications on regions surrounding the conserved His-containing motifs while maintaining their integrity .

  • Modulation of Substrate Specificity: Engineer CA2 variants with altered substrate preferences to selectively enhance the production of specific xanthophylls with nutritional or commercial value, such as zeaxanthin, which has been associated with eye health benefits.

  • Stability Enhancement: Introduce mutations that increase protein stability without compromising catalytic activity, potentially leading to higher steady-state levels of the enzyme and enhanced pathway flux.

  • Subcellular Targeting Optimization: Modify the chloroplast transit peptide of CA2 to enhance its import efficiency into plastids or target the enzyme to specific sub-plastidial compartments where substrate availability is highest.

  • Promoter Engineering: Couple engineered CA2 variants with tissue-specific or inducible promoters to control carotenoid biosynthesis in specific plant tissues or developmental stages.

  • Metabolic Channeling Enhancement: Engineer protein-protein interaction domains into CA2 to promote its association with other carotenogenic enzymes, potentially creating metabolic channels that enhance pathway efficiency.

These engineering approaches should be informed by the successful enhancement of β-carotene content achieved in Golden Rice through engineering of the carotenoid biosynthetic pathway . When implementing such strategies, researchers should consider potential feedback mechanisms and regulatory constraints that might limit the effectiveness of CA2 engineering in isolation from other pathway components.

What potential applications exist for recombinant CA2 in studying human health benefits of carotenoids?

Recombinant CA2 provides a valuable tool for investigating the health-promoting properties of carotenoids and their derivatives, with several promising research applications:

  • Production of Bioactive Compounds: Utilize recombinant CA2 in biocatalytic systems to produce highly pure zeaxanthin and other xanthophylls for human health studies. These compounds have been associated with reduced risk of age-related macular degeneration and other conditions .

  • Metabolism Studies: Employ recombinant CA2 to generate isotopically labeled carotenoids for tracking their metabolism and distribution in animal models, providing insights into bioavailability and tissue-specific accumulation patterns.

  • Structure-Activity Relationship Analysis: Generate diverse carotenoid derivatives through controlled biocatalysis with CA2 and other enzymes to systematically investigate structure-activity relationships in antioxidant efficacy and other biological functions.

  • Investigation of Anti-Inflammatory Properties: Explore the potential anti-inflammatory effects of zeaxanthin and related compounds in cellular models of inflammation, building on evidence that carotenoids from Capsicum annuum possess anti-inflammatory properties .

  • Metabolic Syndrome Research: Study how carotenoids produced by CA2 activity may influence components of metabolic syndrome, including obesity, dyslipidemia, hypertension, and hyperglycemia. Research has shown that Capsicum annuum derivatives can potentially address these conditions through multiple mechanisms .

  • Synergistic Interactions: Investigate potential synergistic interactions between different carotenoids and other bioactive compounds like capsaicin in mediating health benefits, as suggested by studies on Capsicum annuum constituents .

Capsicum annuum and its constituents have demonstrated potential in addressing components of metabolic syndrome through mechanisms including inhibition of digestive enzymes, antioxidant activity, and modulation of insulin sensitivity . The availability of recombinant CA2 enables more precise investigation of the specific contributions of carotenoids to these health effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.