Recombinant Capsicum annuum CASP-like protein PIMP1 (PIMP1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of PIMP1

PIMP1 (Pathogen-Induced Membrane Protein 1), also designated CaPIMP1, belongs to the CASP-like protein family. Key features include:

  • Gene Name: PIMP1 (LOC107870211 in Capsicum annuum) .

  • Protein Length: 166 amino acids (full-length isoform) with a predicted molecular mass of ~38 kDa .

  • Structural Domains: Contains conserved CASP-like motifs, though specific domain architecture remains under investigation.

Recombinant Production Systems

Recombinant PIMP1 is produced using heterologous expression systems to study its biochemical and functional properties. Available variants include:

Product CodeHost SystemTagProtein LengthPuritySource
MBS1202802E. coli, YeastNoneFull-length≥85%MyBioSource
RFL19223CFE. coliHis-tag1-166≥85%Creative BioMart
Partial constructsMammalian/BaculovirusVariablePartial≥85%

Key Notes:

  • E. coli is the predominant host due to cost-effectiveness and high yield .

  • Recombinant PIMP1 retains enzymatic activity post-purification, as confirmed by SDS-PAGE and functional assays .

Role in Plant Defense

  • Pathogen Induction: PIMP1 expression is upregulated during pathogen attack, suggesting involvement in membrane-associated defense signaling .

  • Interaction Networks: Preliminary studies indicate interactions with other stress-responsive proteins, though specific partners remain unidentified .

Stress Response Mechanisms

  • Cold and Osmotic Stress: While direct evidence for PIMP1 is limited, homologs like CaPF1 (a pepper ERF/AP2 transcription factor) show dual roles in biotic/abiotic stress tolerance, hinting at potential cross-talk mechanisms .

  • Reactive Oxygen Species (ROS): Analogous to CaPIK1, a pepper RLCK protein, PIMP1 may modulate ROS bursts during pathogen responses .

Applications in Biotechnology

  • Drug Development: Recombinant PIMP1 serves as a tool for studying plant-pathogen interactions, aiding in the design of disease-resistant crops .

  • Structural Studies: Used in crystallography and mutagenesis to map functional domains .

Challenges and Future Directions

  • Functional Validation: The exact biochemical role of PIMP1 in membrane signaling requires further elucidation.

  • Agricultural Engineering: Potential for transgenic overexpression in crops to enhance stress tolerance, akin to CaPF1 in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PIMP1; CASP-like protein PIMP1; CASP-like protein 4D1; CaCASPL4D1; Pathogen-induced membrane protein 1; CaPIMP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Capsicum annuum (Bell pepper)
Target Names
PIMP1
Target Protein Sequence
MTPPPTSTVPPYVSLIVRILTLICLLISFIVIATNNQTVSTVAGDVKIKFKDFYAYRYLI ATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKFISYFLVTGAAASFGMTQD LKQLEGSDNYSKFLNTSNAAASLCLIGFFFAVASSIFSSYNLPKRI
Uniprot No.

Target Background

Function
Essential for defense against *Xanthomonas campestris* pv. *vesicatoria* (Xcv). In heterologous expression systems, it confers resistance to bacterial pathogens such as *Pseudomonas syringae* pv. *tomato*, but susceptibility to oomycete pathogens like *Hyaloperonospora parasitica* when expressed in *Arabidopsis thaliana*. It may also play a role in regulating responses to biotic and abiotic stresses.
Database Links

KEGG: cann:107870211

UniGene: Can.110524

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in stems and flowers.

Q&A

What is the functional role of PIMP1 in Capsicum annuum defense responses?

PIMP1 appears to function similarly to other characterized pepper defense proteins that regulate immune responses against pathogens. Based on homologous proteins, PIMP1 likely participates in pathogen recognition and downstream defense signaling. Current research suggests that pepper defense proteins like CaPIK1 are transcriptionally activated upon pathogen infection and contribute to salicylic acid (SA)-dependent defense responses . Similar proteins such as CaARP1 have been shown to positively regulate plant immunity against pathogens like Phytophthora capsici .

When investigating PIMP1 function, researchers should design experiments that:

  • Measure transcriptional changes following pathogen challenge

  • Assess protein accumulation patterns during infection

  • Evaluate its role in hormone signaling networks (particularly SA pathways)

  • Determine its contribution to hypersensitive response (HR)-like cell death

How is PIMP1 expression regulated during biotic and abiotic stress conditions?

Expression regulation of defense proteins in pepper often follows distinct temporal patterns. For example, CaARP1 transcript accumulation is upregulated as early as 0.25 hours post-inoculation with P. capsici, peaking at 0.5 hours, followed by downregulation at 12 hours . Similarly, CaPIK1 is transcriptionally activated by Xanthomonas campestris pv. vesicatoria infection .

Methodological approaches to assess PIMP1 regulation should include:

  • Quantitative RT-PCR analysis at multiple timepoints post-infection

  • Protein accumulation assessment via western blotting

  • Promoter analysis to identify regulatory elements

  • Evaluation under different hormonal treatments (particularly SA)

  • Analysis of tissue-specific expression patterns

What is the subcellular localization of PIMP1 and how does it relate to function?

Defense-related proteins in peppers exhibit specific subcellular localizations that are crucial for their function. For example, CaPIK1 exists in the cytoplasm and localizes to the plasma membrane via its N-terminus , while CaARP1 interacts with CaSGT1 at the plasma membrane .

To determine PIMP1 localization, researchers should:

  • Generate fluorescent protein fusions (GFP, YFP, etc.)

  • Perform confocal microscopy on transiently transformed plant cells

  • Use subcellular fractionation followed by immunoblotting

  • Conduct bimolecular fluorescence complementation (BiFC) to visualize interactions with known partners

  • Identify functional domains responsible for specific localizations

How does PIMP1 interact with other defense-related proteins in the Capsicum immune network?

Protein-protein interactions are fundamental to defense signaling networks. For example, CaARP1 interacts with CaSGT1, and this interaction is crucial for the plant's defense response . The CaARP1-CaSGT1 interaction was confirmed through multiple complementary approaches including yeast two-hybrid, bimolecular fluorescence complementation (BiFC), and microscale thermophoresis (MST) .

To characterize PIMP1 interactions, researchers should:

  • Conduct yeast two-hybrid screening to identify potential interacting partners

  • Validate interactions using BiFC in planta

  • Quantify binding affinities using MST or isothermal titration calorimetry

  • Perform co-immunoprecipitation from plant tissues during infection

  • Map interaction domains through truncation and mutation analysis

What structural features of PIMP1 contribute to its immunological function?

Structural analysis of defense proteins reveals conserved domains that contribute to function. For example, CaARP1 belongs to the auxin-repressed superfamily (pfam05564), which contains plant dormancy-associated and auxin-repressed proteins . CaARP1 shares high sequence identity with homologs from other Solanaceae species (91-93%) .

For PIMP1 structural analysis, consider:

  • Protein sequence alignment with homologs from related species

  • Conserved domain identification using databases like NCBI CDD or Pfam

  • Secondary structure prediction using computational tools

  • Three-dimensional structure modeling using homology-based approaches

  • Structure-guided mutagenesis to validate functional domains

How does PIMP1 contribute to the hypersensitive response and ROS production?

Defense proteins often regulate hypersensitive response (HR)-like cell death and reactive oxygen species (ROS) production. For instance, transient expression of CaPIK1 in pepper leaves induces ROS generation and ultimately leads to hypersensitive cell death . Similarly, CaARP1 positively regulates HR-like cell death and hydrogen peroxide accumulation mediated by the elicitin PcINF1 .

To assess PIMP1's role in HR and ROS production:

  • Perform transient expression assays in pepper leaves

  • Quantify cell death using trypan blue staining

  • Measure ROS production using DAB (3,3′-diaminobenzidine) staining for H₂O₂

  • Monitor expression of ROS-related genes using qRT-PCR

  • Use ROS scavengers to determine causality between ROS and cell death

What expression systems are optimal for producing recombinant PIMP1 protein?

Selection of an appropriate expression system is critical for obtaining functional recombinant PIMP1. While the search results don't specifically address recombinant expression of pepper defense proteins, standard approaches can be applied.

Consider these expression strategies:

  • Prokaryotic systems (E. coli): Use for high yield but potential issues with folding

  • Yeast expression: Better for eukaryotic proteins requiring post-translational modifications

  • Insect cell systems: Suitable for complex plant proteins

  • Plant-based expression: Most likely to maintain native folding and modifications

A systematic comparison of expression systems could be presented as follows:

Expression SystemAdvantagesDisadvantagesRecommended TagsPurification Strategy
E. coliHigh yield, low costPotential misfoldingHis, GST, MBPAffinity chromatography followed by size exclusion
Yeast (P. pastoris)Eukaryotic processingLonger production timeHis, FLAGAffinity and ion exchange chromatography
Insect cellsComplex PTMsHigher costHis, StrepMultiple chromatography steps
Plant expressionNative conditionsLower yieldHis, GFPAffinity chromatography

How can gene silencing approaches be optimized to study PIMP1 function?

Gene silencing is extensively used to study defense protein function in peppers. For example, silencing of CaARP1 promoted vegetative growth in pepper plants while attenuating disease resistance to P. capsici . Similarly, CaPIK1-silenced plants showed enhanced susceptibility to Xanthomonas infection .

For effective PIMP1 silencing experiments:

  • Design specific gene fragments (300-500 bp) with minimal off-target potential

  • Use virus-induced gene silencing (VIGS) vectors optimized for Solanaceae

  • Include positive controls (PDS gene causing photobleaching) to confirm silencing efficiency

  • Verify silencing through qRT-PCR and western blot

  • Assess multiple independent silenced plants to account for variability

What bioassays are most informative for assessing PIMP1's role in plant immunity?

Comprehensive phenotypic analysis is essential for understanding defense protein function. Various bioassays have been used to characterize pepper defense proteins, including pathogen challenge, cell death quantification, and ROS measurement.

Recommended bioassays include:

  • Pathogen growth assays: Measure P. capsici or bacterial pathogen proliferation in silenced vs. control plants

  • HR-like cell death assays: Use trypan blue staining to visualize and quantify cell death

  • ROS detection: Apply DAB staining to measure H₂O₂ accumulation

  • Defense gene expression: Monitor SA-responsive markers through qRT-PCR

  • Hormone quantification: Measure SA levels using HPLC or LC-MS/MS

How can contradictory results in PIMP1 functional studies be reconciled?

Defense proteins often exhibit complex, context-dependent functions. For example, CaARP1 plays a dual role in pepper plants - negatively regulating vegetative growth while positively regulating immunity against P. capsici .

To resolve contradictory findings in PIMP1 research:

  • Carefully control experimental conditions (plant age, growth conditions, pathogen strains)

  • Use multiple independent silencing or overexpression lines

  • Apply complementary approaches (genetics, biochemistry, cell biology)

  • Consider spatial and temporal dynamics of protein function

  • Assess potential redundancy with related proteins

What bioinformatic approaches can predict PIMP1 interaction networks?

Computational analysis can predict functional relationships and guide experimental work. For PIMP1, researchers should consider:

  • Sequence similarity searches to identify homologs in other species

  • Phylogenetic analysis to understand evolutionary relationships

  • Protein-protein interaction prediction using tools such as STRING or PRINCE

  • Co-expression analysis using available transcriptomic datasets

  • Domain-based interaction prediction based on known interacting domains

How can transcriptomic data illuminate PIMP1's role in defense signaling networks?

Transcriptomic analysis can reveal how PIMP1 functions within broader defense networks. Based on studies of other pepper defense proteins, PIMP1 likely influences expression of defense-related genes.

For transcriptomic experiments:

  • Compare wild-type vs. PIMP1-silenced plants before and after pathogen challenge

  • Analyze early (0-6h) and late (24-72h) transcriptional responses

  • Identify differentially expressed gene clusters using appropriate statistical methods

  • Perform Gene Ontology and pathway enrichment analysis

  • Validate key findings using qRT-PCR and functional assays

What are the challenges in producing antibodies against PIMP1 for immunodetection?

Generating specific antibodies against plant defense proteins presents several challenges. For PIMP1 antibody production, consider:

  • Selection of antigenic regions unique to PIMP1 versus related proteins

  • Production of recombinant protein fragments as antigens

  • Validation of antibody specificity using knockout/silenced plant materials

  • Optimization of extraction conditions to preserve protein integrity

  • Development of sensitive detection methods for low-abundance proteins

How can CRISPR/Cas9 genome editing be applied to study PIMP1 function?

While traditional VIGS approaches have been used for pepper defense proteins , CRISPR/Cas9 offers advantages for precise genetic manipulation:

  • Design multiple guide RNAs targeting different PIMP1 exons

  • Optimize transformation protocols for recalcitrant pepper genotypes

  • Screen for homozygous knockout lines using sequencing

  • Characterize phenotypes across developmental stages

  • Create domain-specific mutations to dissect protein function

What approaches can distinguish PIMP1-specific effects from general stress responses?

Defense proteins can trigger broad stress responses that may confound functional analysis. To identify PIMP1-specific effects:

  • Use inducible expression systems to control timing of PIMP1 activation

  • Compare transcriptional profiles with those of other defense protein manipulations

  • Perform epistasis analysis with known defense signaling components

  • Assess phenotypes under varied environmental conditions

  • Combine genetic and biochemical approaches to establish direct relationships

How can knowledge of PIMP1 function contribute to breeding disease-resistant pepper varieties?

Understanding defense protein function can inform crop improvement strategies. For PIMP1 application in breeding:

  • Assess natural variation in PIMP1 sequence and expression across pepper germplasm

  • Identify haplotypes associated with enhanced disease resistance

  • Develop molecular markers for marker-assisted selection

  • Consider potential growth-defense tradeoffs, as observed with CaARP1

  • Evaluate transgenic approaches for enhanced expression in elite varieties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.