UniProt ID: P86001
EC Number: 1.11.1.7
Source: Recombinant protein expressed in Pichia pastoris yeast .
Sequence: The N-terminal region (residues 1–45) includes the conserved motif GFEVIDNIKDSVVILGGPNWNVKMGDIRPLTGSNGEIRFDNNYFK, critical for catalytic activity .
| Property | Value | Source |
|---|---|---|
| Molecular Weight | ~58 kDa (including His-tag) | |
| Purity | >85% (SDS-PAGE verified) | |
| Storage Stability | -20°C (short-term); -80°C (long-term) | |
| Expression System | Pichia pastoris |
Cloning: Codon-optimized CaPOD3 was cloned into Pichia pastoris for high-yield expression .
Purification: Immobilized metal affinity chromatography (IMAC) using a 10xHis tag yields >85% pure protein .
Activity: Despite successful expression, recombinant CaPrx3 may require refolding or cofactors for full enzymatic activity, as observed in related systems .
Substrate Specificity: Oxidizes phenolic compounds (e.g., guaiacol) using H₂O₂ as a co-substrate .
Inhibition:
| Condition | Effect on CaPrx3 Activity | Reference |
|---|---|---|
| 0.5–5.0 mM SIN-1 (ONOO⁻ donor) | Complete inhibition | |
| 10 mM Glutathione | ~80% inhibition | |
| Nitric Oxide (NO) gas | Differential gene regulation |
Fruit Ripening: CaPrx3 expression is downregulated during pepper fruit maturation, correlating with H₂O₂ accumulation .
Stress Response: Participates in detoxifying reactive oxygen species (ROS) under biotic/abiotic stress .
Capsicum annuum Peroxidase 3 (CaPOD3) is a class III peroxidase with the following characteristics:
UniProt accession number: P86001
EC number: 1.11.1.7
Amino acid sequence (expression region 1-45): GFEVIDNIKD SVVILGGPNW NVKMGDIRPL TGSNGEIRFD NNYFK
Purity of recombinant protein: >85% (SDS-PAGE)
Storage recommendation: -20°C for regular storage, -20°C or -80°C for extended storage
The enzyme belongs to a larger family of class III peroxidases that exist as multigene families in higher plants. Based on analysis of the pepper genome, approximately 75 CaPOD genes have been identified, but only 10 are expressed in fruit transcriptomes . These enzymes typically contain a heme group essential for their catalytic activity in oxidizing phenolic compounds while consuming hydrogen peroxide.
Several expression systems have been employed for recombinant peroxidase production, with varying advantages:
Yeast Expression System:
Commonly used for CaPOD3 production
Advantages include post-translational modifications and proper protein folding
E. coli Expression Systems:
While not specifically documented for CaPOD3, E. coli has been successfully used for other plant peroxidases
For horseradish peroxidase (HRP), a successful multi-step inclusion body process has been developed yielding 960 mg active HRP/L culture medium with ≥99% purity
Challenges include proper folding and heme incorporation
Cell-Free Protein Synthesis (CFPS):
An innovative approach combining E. coli extract with heme synthesis pathway
Allows controlled environment for cofactor incorporation
Requires optimization of reaction conditions and DNA template sequence
For laboratory-scale production, the following reconstitution protocol is recommended:
Centrifuge the vial briefly before opening
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add glycerol to 5-50% final concentration (50% recommended)
Peroxidases in pepper plants, including CaPOD3, serve critical roles in defense responses:
Pathogen Response:
POD activity significantly increases during pathogen infection
In pepper infected with Phytophthora capsici, peroxidase activity increases during early infection stages
CaSBP08-silenced pepper plants showed increased POD activity correlating with enhanced resistance against P. capsici
Abiotic Stress Response:
Peroxidase activity is modulated during salt and drought stress
CaDHN3-overexpressed plants showed higher peroxidase (POD) activity when subjected to salt and drought stresses
Enhanced POD activity leads to lower H₂O₂ content, reducing oxidative damage
ROS Management:
Peroxidases regulate H₂O₂ levels by:
Consuming H₂O₂ in phenolic compound oxidation
Generating H₂O₂ through oxidative cycles
This dual function allows fine control of reactive oxygen species signaling
A comparison of peroxidase activity during different stress conditions in pepper:
Activity Assays:
Spectrophotometric assays using guaiacol as substrate (λ = 470 nm)
ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid)) and TMB (3,3',5,5'-tetramethylbenzidine) can be used as reducing substrates
Reinheitszahl value (RZ value = A403/A280) is used to determine purity and heme incorporation
Isozyme Separation:
Non-denaturing PAGE (8% polyacrylamide) followed by in-gel activity staining
Staining solution: 0.1 M sodium acetate buffer (pH 5.5) with 1 mM 3,3-diaminobenzidine and 0.03% H₂O₂
Brown bands appear over colorless background, specific for peroxidase activity
Gene Expression Analysis:
qRT-PCR for expression pattern analysis across tissues and conditions
RNA-Seq for transcriptome-wide analysis
DEgenes-Hunter v0.98 pipeline can be used for differential expression analysis
Functional Analysis:
Virus-induced gene silencing (VIGS) using TRV vectors
Plant transformation for overexpression studies
Bimolecular fluorescence complementation for protein-protein interaction studies
While specific interactions of CaPOD3 have not been fully characterized, research on peroxidases in pepper provides insights into potential interaction networks:
Defense Signaling Pathways:
Peroxidases participate in SA (salicylic acid) and JA (jasmonic acid) mediated defense pathways
Expression of defense genes like CaSAR8.2, CaBPR1, and CaDEF1 correlates with peroxidase activity during pathogen response
ROS Signaling:
CaPO1 (another pepper peroxidase) suppression causes dramatic H₂O₂ accumulation during programmed cell death
This suggests peroxidases like CaPOD3 may interact with components of ROS signaling machinery
Protein Interactions:
In related studies, GLYCINE-RICH RNA-BINDING PROTEIN1 (CaGRP1) has been found to interact with RECEPTOR-LIKE CYTOPLASMIC PROTEIN KINASE1 (CaPIK1) to regulate cell death and defense responses
Similar interaction networks likely exist for peroxidases in stress response pathways
While specific structural information for CaPOD3 is limited, insights from related peroxidases provide valuable information:
Catalytic Mechanism:
Class III peroxidases follow a three-step reaction cycle:
Functional Domains:
Heme-binding domain essential for catalytic activity
Substrate binding sites that determine specificity
Signal peptide for subcellular localization
Post-translational Modifications:
Potential nitration sites: Studies of pepper catalase show that tyrosine nitration can inhibit enzyme activity
In catalase, Tyr348 and Tyr360 were identified as nitration targets near the active center
Similar modifications might regulate CaPOD3 activity
Peroxidase activity undergoes significant changes during pepper fruit development:
Temporal Changes:
Total peroxidase activity decreases by approximately 50% in ripe (red) fruits compared to immature green fruits
This decrease correlates with changes in other physiological parameters like chlorophyll content and pH
Isozyme Profiles:
Four CaPOD isozymes (CaPOD I-IV) have been identified in pepper fruits
These isozymes are differentially modulated during ripening
CaPOD IV is particularly susceptible to nitration and reducing events that lead to its inhibition
Gene Expression Patterns:
Acidic isoenzymes increase during ripening
Basic isoenzymes decrease during the same period
Subcellular Distribution:
Most peroxidase activity is localized in the soluble fraction throughout development
This subcellular localization is maintained during the ripening process
Genetic engineering approaches targeting peroxidases offer promising strategies for crop improvement:
Overexpression Studies:
Overexpression of stress-responsive genes like CaDHN3 enhances antioxidant enzyme activities, including POD
Transgenic Arabidopsis plants overexpressing CaDHN3 showed increased POD activity, correlating with enhanced salt and drought tolerance
Gene Silencing:
VIGS (Virus-Induced Gene Silencing) is an effective tool for studying peroxidase function in pepper
CaSBP08-silenced pepper plants showed altered peroxidase activity and modified pathogen resistance
Various Agrobacterium infection methods can be optimized for efficient gene silencing in pepper
Considerations for Experimental Design:
Expression and Purification:
Ensuring proper heme incorporation is critical for functional enzyme
Inclusion body formation in bacterial expression systems requires optimized refolding protocols
For cell-free systems, combining translational machinery with heme synthesis pathways requires careful optimization
Activity Preservation:
Avoid repeated freeze-thaw cycles that can reduce enzyme activity
Work with aliquots at 4°C for up to one week
For reconstitution, deionized sterile water and glycerol addition (final 5-50%) are recommended
Specificity Verification:
In activity assays, always include controls without H₂O₂ to confirm band specificity
For recombinant protein, verify purity via SDS-PAGE (should be >85%)
Storage Stability:
Liquid form shelf life: approximately 6 months at -20°C/-80°C
Lyophilized form shelf life: approximately 12 months at -20°C/-80°C
Shelf life depends on buffer ingredients, storage temperature, and the protein's inherent stability
Structural Biology:
Crystal structure determination would provide insights into substrate specificity
Structure-based design of specific inhibitors or activity enhancers
Systems Biology Approaches:
Integration of transcriptomics, proteomics, and metabolomics data to understand peroxidase networks
Machine learning approaches to predict peroxidase functions based on sequence and expression patterns
Applied Research:
Development of peroxidase-based biosensors for stress detection in plants
Engineering peroxidases with enhanced stability or altered substrate specificity
Exploring the potential of peroxidases in bioremediation applications
Multiomics Integration: