Recombinant Capsicum annuum Peroxidase 3

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Basic Properties

UniProt ID: P86001
EC Number: 1.11.1.7
Source: Recombinant protein expressed in Pichia pastoris yeast .
Sequence: The N-terminal region (residues 1–45) includes the conserved motif GFEVIDNIKDSVVILGGPNWNVKMGDIRPLTGSNGEIRFDNNYFK, critical for catalytic activity .

Table 1: Key biochemical parameters

PropertyValueSource
Molecular Weight~58 kDa (including His-tag)
Purity>85% (SDS-PAGE verified)
Storage Stability-20°C (short-term); -80°C (long-term)
Expression SystemPichia pastoris

Expression and Purification

  • Cloning: Codon-optimized CaPOD3 was cloned into Pichia pastoris for high-yield expression .

  • Purification: Immobilized metal affinity chromatography (IMAC) using a 10xHis tag yields >85% pure protein .

  • Activity: Despite successful expression, recombinant CaPrx3 may require refolding or cofactors for full enzymatic activity, as observed in related systems .

Enzymatic Activity

  • Substrate Specificity: Oxidizes phenolic compounds (e.g., guaiacol) using H₂O₂ as a co-substrate .

  • Inhibition:

    • Nitrosative Stress: Peroxynitrite (ONOO⁻) and nitric oxide donors inhibit activity via tyrosine nitration .

    • Reducing Agents: Glutathione and L-cysteine reversibly inhibit CaPrx3 .

Table 2: Activity modulation under experimental conditions

ConditionEffect on CaPrx3 ActivityReference
0.5–5.0 mM SIN-1 (ONOO⁻ donor)Complete inhibition
10 mM Glutathione~80% inhibition
Nitric Oxide (NO) gasDifferential gene regulation

Biological and Agricultural Relevance

  • Fruit Ripening: CaPrx3 expression is downregulated during pepper fruit maturation, correlating with H₂O₂ accumulation .

  • Stress Response: Participates in detoxifying reactive oxygen species (ROS) under biotic/abiotic stress .

Technical Applications

  • Biocatalysis: Potential use in industrial processes for lignin modification or dye decolorization .

  • Research Tool: Serves as a model for studying nitro-oxidative stress in plants .

Product Specs

Form
Lyophilized powder. Note: We will preferentially ship the format we have in stock. If you have special format requirements, please note them when ordering, and we will fulfill your request.
Lead Time
Delivery times may vary based on purchasing method and location. Please consult your local distributor for specific delivery times. Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional charges apply.
Notes
Avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening to collect contents at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and protein stability. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, and 12 months for the lyophilized form at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you require a specific tag type, please inform us, and we will prioritize developing it.
Synonyms
Peroxidase 3; EC 1.11.1.7; Fragments
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-45
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Capsicum annuum (Bell pepper)
Target Protein Sequence
GFEVIDNIKD SVVILGGPNW NVKMGDIRPL TGSNGEIRFD NNYFK
Uniprot No.

Target Background

Function
Peroxidase 3 plays a role in several processes, including H₂O₂ removal, oxidation of toxic reducing agents, lignin biosynthesis and degradation, suberization, auxin catabolism, and response to environmental stresses (wounding, pathogen attack, and oxidative stress). These functions may be isozyme/isoform and plant tissue specific.
Protein Families
Peroxidase family, Classical plant (class III) peroxidase subfamily
Subcellular Location
Secreted.

Q&A

Basic Properties and Characterization of Capsicum annuum Peroxidase 3

Q: What are the fundamental properties of Capsicum annuum Peroxidase 3?

Capsicum annuum Peroxidase 3 (CaPOD3) is a class III peroxidase with the following characteristics:

  • UniProt accession number: P86001

  • EC number: 1.11.1.7

  • Amino acid sequence (expression region 1-45): GFEVIDNIKD SVVILGGPNW NVKMGDIRPL TGSNGEIRFD NNYFK

  • Purity of recombinant protein: >85% (SDS-PAGE)

  • Storage recommendation: -20°C for regular storage, -20°C or -80°C for extended storage

The enzyme belongs to a larger family of class III peroxidases that exist as multigene families in higher plants. Based on analysis of the pepper genome, approximately 75 CaPOD genes have been identified, but only 10 are expressed in fruit transcriptomes . These enzymes typically contain a heme group essential for their catalytic activity in oxidizing phenolic compounds while consuming hydrogen peroxide.

Expression Systems and Recombinant Production

Q: What are the optimal expression systems for recombinant Capsicum annuum Peroxidase 3 production?

Several expression systems have been employed for recombinant peroxidase production, with varying advantages:

Yeast Expression System:

  • Commonly used for CaPOD3 production

  • Advantages include post-translational modifications and proper protein folding

  • The recombinant protein from Cusabio is produced in yeast

E. coli Expression Systems:

  • While not specifically documented for CaPOD3, E. coli has been successfully used for other plant peroxidases

  • For horseradish peroxidase (HRP), a successful multi-step inclusion body process has been developed yielding 960 mg active HRP/L culture medium with ≥99% purity

  • Challenges include proper folding and heme incorporation

Cell-Free Protein Synthesis (CFPS):

  • An innovative approach combining E. coli extract with heme synthesis pathway

  • Allows controlled environment for cofactor incorporation

  • Requires optimization of reaction conditions and DNA template sequence

For laboratory-scale production, the following reconstitution protocol is recommended:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

Biological Functions in Plant Defense

Q: How does Capsicum annuum Peroxidase 3 contribute to plant defense mechanisms?

Peroxidases in pepper plants, including CaPOD3, serve critical roles in defense responses:

Pathogen Response:

  • POD activity significantly increases during pathogen infection

  • In pepper infected with Phytophthora capsici, peroxidase activity increases during early infection stages

  • CaSBP08-silenced pepper plants showed increased POD activity correlating with enhanced resistance against P. capsici

Abiotic Stress Response:

  • Peroxidase activity is modulated during salt and drought stress

  • CaDHN3-overexpressed plants showed higher peroxidase (POD) activity when subjected to salt and drought stresses

  • Enhanced POD activity leads to lower H₂O₂ content, reducing oxidative damage

ROS Management:

  • Peroxidases regulate H₂O₂ levels by:

    • Consuming H₂O₂ in phenolic compound oxidation

    • Generating H₂O₂ through oxidative cycles

  • This dual function allows fine control of reactive oxygen species signaling

A comparison of peroxidase activity during different stress conditions in pepper:

Stress ConditionPOD Activity ChangeAssociated Defense Response
P. capsici infectionIncreased by 96.6% (48h after insecticide application)Enhanced pathogen resistance
Salt stressIncreased in resistant varietiesReduced H₂O₂ accumulation
Drought stressIncreased in resistant varietiesReduced lipid peroxidation
Pesticide exposureIncreased by 170.2% (48h after insecticide application)Xenobiotic detoxification

Experimental Techniques for Studying CaPOD3

Q: What are the most effective methods for analyzing Capsicum annuum Peroxidase 3 activity and function?

Activity Assays:

  • Spectrophotometric assays using guaiacol as substrate (λ = 470 nm)

  • ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid)) and TMB (3,3',5,5'-tetramethylbenzidine) can be used as reducing substrates

  • Reinheitszahl value (RZ value = A403/A280) is used to determine purity and heme incorporation

Isozyme Separation:

  • Non-denaturing PAGE (8% polyacrylamide) followed by in-gel activity staining

  • Staining solution: 0.1 M sodium acetate buffer (pH 5.5) with 1 mM 3,3-diaminobenzidine and 0.03% H₂O₂

  • Brown bands appear over colorless background, specific for peroxidase activity

Gene Expression Analysis:

  • qRT-PCR for expression pattern analysis across tissues and conditions

  • RNA-Seq for transcriptome-wide analysis

  • DEgenes-Hunter v0.98 pipeline can be used for differential expression analysis

Functional Analysis:

  • Virus-induced gene silencing (VIGS) using TRV vectors

  • Plant transformation for overexpression studies

  • Bimolecular fluorescence complementation for protein-protein interaction studies

Protein-Protein Interactions and Signaling Pathways

Q: How does Capsicum annuum Peroxidase 3 interact with other proteins in plant stress response networks?

While specific interactions of CaPOD3 have not been fully characterized, research on peroxidases in pepper provides insights into potential interaction networks:

Defense Signaling Pathways:

  • Peroxidases participate in SA (salicylic acid) and JA (jasmonic acid) mediated defense pathways

  • Expression of defense genes like CaSAR8.2, CaBPR1, and CaDEF1 correlates with peroxidase activity during pathogen response

ROS Signaling:

  • CaPO1 (another pepper peroxidase) suppression causes dramatic H₂O₂ accumulation during programmed cell death

  • This suggests peroxidases like CaPOD3 may interact with components of ROS signaling machinery

Protein Interactions:

  • In related studies, GLYCINE-RICH RNA-BINDING PROTEIN1 (CaGRP1) has been found to interact with RECEPTOR-LIKE CYTOPLASMIC PROTEIN KINASE1 (CaPIK1) to regulate cell death and defense responses

  • Similar interaction networks likely exist for peroxidases in stress response pathways

Structural and Functional Analysis

Q: What are the key structural features that determine CaPOD3 function?

While specific structural information for CaPOD3 is limited, insights from related peroxidases provide valuable information:

Catalytic Mechanism:

  • Class III peroxidases follow a three-step reaction cycle:

    • Native enzyme oxidation by H₂O₂ to form Compound I

    • Reduction of Compound I by substrate to form Compound II

    • Return to native enzyme through second substrate oxidation

Functional Domains:

  • Heme-binding domain essential for catalytic activity

  • Substrate binding sites that determine specificity

  • Signal peptide for subcellular localization

Post-translational Modifications:

  • Potential nitration sites: Studies of pepper catalase show that tyrosine nitration can inhibit enzyme activity

  • In catalase, Tyr348 and Tyr360 were identified as nitration targets near the active center

  • Similar modifications might regulate CaPOD3 activity

Changes During Fruit Development and Ripening

Q: How does Capsicum annuum Peroxidase 3 activity change during fruit development?

Peroxidase activity undergoes significant changes during pepper fruit development:

Temporal Changes:

  • Total peroxidase activity decreases by approximately 50% in ripe (red) fruits compared to immature green fruits

  • This decrease correlates with changes in other physiological parameters like chlorophyll content and pH

Isozyme Profiles:

  • Four CaPOD isozymes (CaPOD I-IV) have been identified in pepper fruits

  • These isozymes are differentially modulated during ripening

  • CaPOD IV is particularly susceptible to nitration and reducing events that lead to its inhibition

Gene Expression Patterns:

  • Acidic isoenzymes increase during ripening

  • Basic isoenzymes decrease during the same period

  • These changes correlate with capsaicin metabolism

Subcellular Distribution:

  • Most peroxidase activity is localized in the soluble fraction throughout development

  • This subcellular localization is maintained during the ripening process

Genetic Engineering Applications

Q: How can genetic manipulation of Capsicum annuum Peroxidase 3 enhance crop resilience?

Genetic engineering approaches targeting peroxidases offer promising strategies for crop improvement:

Overexpression Studies:

  • Overexpression of stress-responsive genes like CaDHN3 enhances antioxidant enzyme activities, including POD

  • Transgenic Arabidopsis plants overexpressing CaDHN3 showed increased POD activity, correlating with enhanced salt and drought tolerance

Gene Silencing:

  • VIGS (Virus-Induced Gene Silencing) is an effective tool for studying peroxidase function in pepper

  • CaSBP08-silenced pepper plants showed altered peroxidase activity and modified pathogen resistance

  • Various Agrobacterium infection methods can be optimized for efficient gene silencing in pepper

Considerations for Experimental Design:

Experimental Challenges and Troubleshooting

Q: What are common technical challenges when working with recombinant Capsicum annuum Peroxidase 3?

Expression and Purification:

  • Ensuring proper heme incorporation is critical for functional enzyme

  • Inclusion body formation in bacterial expression systems requires optimized refolding protocols

  • For cell-free systems, combining translational machinery with heme synthesis pathways requires careful optimization

Activity Preservation:

  • Avoid repeated freeze-thaw cycles that can reduce enzyme activity

  • Work with aliquots at 4°C for up to one week

  • For reconstitution, deionized sterile water and glycerol addition (final 5-50%) are recommended

Specificity Verification:

  • In activity assays, always include controls without H₂O₂ to confirm band specificity

  • For recombinant protein, verify purity via SDS-PAGE (should be >85%)

Storage Stability:

  • Liquid form shelf life: approximately 6 months at -20°C/-80°C

  • Lyophilized form shelf life: approximately 12 months at -20°C/-80°C

  • Shelf life depends on buffer ingredients, storage temperature, and the protein's inherent stability

Future Research Directions

Q: What are promising avenues for further research on Capsicum annuum Peroxidase 3?

Structural Biology:

  • Crystal structure determination would provide insights into substrate specificity

  • Structure-based design of specific inhibitors or activity enhancers

Systems Biology Approaches:

  • Integration of transcriptomics, proteomics, and metabolomics data to understand peroxidase networks

  • Machine learning approaches to predict peroxidase functions based on sequence and expression patterns

Applied Research:

  • Development of peroxidase-based biosensors for stress detection in plants

  • Engineering peroxidases with enhanced stability or altered substrate specificity

  • Exploring the potential of peroxidases in bioremediation applications

Multiomics Integration:

  • Combining transcriptome data (75 CaPOD genes identified in genome but only 10 found in fruit transcriptome) with proteome and activity studies to understand tissue-specific regulation

  • Investigation of epigenetic regulation of peroxidase gene expression during development and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.