Recombinant Capsular polysaccharide biosynthesis protein CapD (capD)

Shipped with Ice Packs
In Stock

Description

Domain Architecture and Catalytic Mechanism

CapD belongs to the γ-glutamyltranspeptidase (GGT) family, characterized by an N-terminal nucleophile hydrolase domain. Structural studies reveal:

  • Bacillus anthracis CapD: The enzyme cleaves itself at a conserved GGT consensus site (Thr352), forming two subunits (α and β) that remain associated for activity .

  • Catalytic Residues: A conserved Ser-Pro motif and Asp-Glu dyad enable Mg²⁺-dependent glycosyltransferase activity, critical for lipid-linked CPS precursor synthesis .

  • Membrane Association: CapD integrates into the cell membrane via transmembrane helices, positioning it to interact with peptidoglycan and lipid II substrates .

Table 2: Phenotypic Changes in capD Mutants

SpeciesCPS ProductionCell Wall ThicknessBiofilm FormationAdhesion
E. miricola↓ 45%↓ 45%Unchanged↑ 2.3-fold
G. parasuis↓ 60%UnreportedLost↑ 1.5-fold
E. faecium↓ 30%Altered morphologyReduced↓ 50%

Vaccine and Drug Targets

  • Anthrax Countermeasures: B. anthracis CapD is a validated target; covalent inhibitors like capsidin block capsule anchoring, reducing virulence .

  • Anti-Biofilm Agents: Targeting CapD in G. parasuis or E. faecium could disrupt biofilm-mediated antibiotic resistance .

Recombinant CapD in Research

  • Expression Systems: Recombinant CapD from B. anthracis and G. parasuis has been purified using E. coli systems, enabling structural and enzymatic studies .

  • Enzymatic Assays: Fluorogenic substrates and mass spectrometry confirm CapD’s γ-glutamyltranspeptidase activity, with a catalytic efficiency (kcat/Kmk_{cat}/K_m) of 1.2×104M1s11.2 \times 10^4 \, \text{M}^{-1}\text{s}^{-1} .

Future Directions

  • Mechanistic Studies: Resolve unresolved steps in CPS precursor transfer, particularly the role of LytR-CpsA-Psr (LCP) family proteins .

  • Cross-Species Inhibitors: Develop broad-spectrum inhibitors targeting conserved CapD motifs (e.g., PRP motif in S. aureus) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it for you.
Synonyms
capD; Capsular polysaccharide biosynthesis protein CapD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
capD
Target Protein Sequence
MTSISAKLRFLILIIIDSFIVTFSVFLGYAILEPYFKGYSIDLLVLSSVILLVSHHIFAY VFNLYHRAWEYASVSELMSVLKAVTSSIVVTLLLVSLLISESPFLRLYFITWMMHLLLIG GSRLFWRVYRRYFIDNAVEKKATLVVGAGQGGSVLIREMLRSQDMRMQPVLAVDDDKNKQ KMTITERVKVQGYVEDIPELVKKFRIKKIIIAIPTLSQKRLNEINKICNIEGVELFKMPN IEDVLSGELEVNNLKKVEVEDLLGRDPVELDMALISRELTNKTILVTGAGGSIGSEICRQ VSKFDPQKIILLGHGENSIYSIHQELSKTYGNRIEFVPVIADVQNKTRILEVMNEFKPYA VYHAAAHKHVPLMEYNPHEAIRNNILGTKNVAESAKEGEVSKFVMISTDKAVNPSNVMGA TKRIAEMVIQSLNEDNSKTSFVAVRFGNVLGSRGSVIPLFKNQIESGGPVTVTHPEMTRY FMTIPEASRLVLQAGALAQGGEVFVLDMGKPVKIVDLAKNLIRLSGKKEEDIGIEFSGIR PGEKLYEELLNKNEIHPQQVYEKIYRGKVDHYIKTEVDLIVEDLINNFSKEKLLKIANR
Uniprot No.

Target Background

Function
Essential for the biosynthesis of type 1 capsular polysaccharide.
Protein Families
Polysaccharide synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CapD and what is its primary function in capsular polysaccharide biosynthesis?

CapD is a key enzyme involved in the synthesis of the first soluble capsule precursor UDP-d-FucNAc in Staphylococcus aureus capsular polysaccharide (CP) biosynthesis. Molecular characterization has shown that CapD catalyzes the formation of UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose, an intermediate in the CP biosynthetic pathway . This enzyme functions within a complex cascade of reactions that generate the building blocks needed for capsule assembly, working in coordination with other biosynthetic enzymes to ensure proper precursor production. CapD represents a crucial enzymatic checkpoint in the initial stages of CP biosynthesis, making it essential for S. aureus capsule formation.

How can researchers experimentally verify CapD enzymatic activity?

To verify CapD enzymatic activity, researchers can employ the following methodological approach:

  • Protein purification: Express and purify recombinant CapD using affinity chromatography techniques to obtain functionally active enzyme.

  • Enzymatic assay setup: Combine purified CapD with its substrate in appropriate buffer conditions with necessary cofactors.

  • Activity verification: Monitor the conversion of the substrate to UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose using:

    • Capillary electrophoresis (CE) to separate reaction products

    • Mass spectrometry (MS) to confirm the molecular identity of reaction products

  • Reaction monitoring: Track the disappearance of substrate and appearance of product over time to establish enzyme kinetics.

This approach has been successfully implemented in previous studies, where CE-MS analysis confirmed CapD's role in producing the UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose intermediate that CapN subsequently reduces to form UDP-d-FucNAc .

What is the relationship between CapD and other CP biosynthesis proteins?

CapD functions within an interconnected network of capsular polysaccharide biosynthesis proteins:

ProteinFunctionRelationship to CapD
CapNNADPH-dependent reductaseConverts CapD's enzymatic product to UDP-d-FucNAc
CapMPriming glycosyltransferaseUses products from the CapD-initiated pathway to begin lipid-linked CP assembly
CapEDehydrataseWorks in a separate cascade generating UDP-L-FucNAc; not directly connected to CapD
CapFEpimerase/dehydrataseWorks in the same pathway as CapE
CapGC2-epimeraseWorks in the same pathway as CapE and CapF
CapA1B1Tyrosine kinase complexDoes not phosphorylate CapD, unlike its targets CapM and CapE

This network demonstrates that CapD operates in one of three cytoplasmic reaction cascades generating soluble precursors needed for CP synthesis, with the products of these pathways eventually converging in the assembly of the complete capsular polysaccharide structure .

How do researchers reconstitute CapD function in vitro for mechanistic studies?

In vitro reconstitution of CapD function requires a systematic approach:

  • Protein expression system selection:

    • Use E. coli BL21(DE3) or similar expression systems for recombinant production

    • Add affinity tags (His6) for purification while ensuring tag position doesn't interfere with enzyme activity

  • Purification protocol optimization:

    • Employ nickel affinity chromatography followed by size exclusion chromatography

    • Verify protein purity using SDS-PAGE and protein identification by mass spectrometry

    • Assess protein folding using circular dichroism spectroscopy

  • Reaction conditions optimization:

    • Test various buffer systems (typically HEPES or Tris-based buffers, pH 7.5-8.0)

    • Determine optimal metal cofactor requirements (Mg²⁺, Mn²⁺)

    • Establish temperature and pH optima for enzymatic activity

  • Analytical methods for product characterization:

    • Use capillary electrophoresis coupled with mass spectrometry for product identification and quantification

    • Employ HPLC for monitoring reaction kinetics

    • Utilize NMR spectroscopy for structural confirmation of reaction products

Successful reconstitution has been demonstrated in previous work, where purified CapD was shown to catalyze the expected reaction with subsequent product verification through established analytical techniques .

What is the significance of CapD not being phosphorylated by the CapA1B1 tyrosine kinase complex?

The observation that CapD is not phosphorylated by the CapA1B1 tyrosine kinase complex, unlike other CP biosynthesis enzymes such as CapM and CapE, has important regulatory implications :

  • Differential regulation: This finding suggests that CapD activity is regulated through mechanisms distinct from the tyrosine phosphorylation cascade that controls other CP biosynthesis enzymes.

  • Regulatory hierarchy: The absence of phosphorylation indicates that CapD may function as a constitutively active enzyme, with regulation occurring at other points in the pathway.

  • Metabolic flux control: Since CapD catalyzes an early step in precursor synthesis, its exemption from tyrosine kinase regulation may ensure consistent supply of the initial building blocks, while downstream enzymes (CapM, CapE) are subject to phosphorylation-based regulation to control flux through the pathway.

  • Integration with cellular metabolism: This regulatory pattern suggests a mechanism by which S. aureus can coordinate capsule production with cell wall biosynthesis, as the CapAB tyrosine kinase complex has been shown to modulate the consumption of essential precursors shared between these pathways .

Experimental evidence demonstrating this lack of phosphorylation was obtained through in vitro phosphorylation assays using purified CapA1B1 complex and recombinant CapD, with phosphorylation detected by specific anti-phosphotyrosine antibodies .

How does the structure of CapD contribute to its catalytic mechanism?

While detailed structural information about CapD is limited in the provided search results, we can infer several important structure-function relationships based on homology and biochemical data:

  • Catalytic domain architecture:

    • CapD likely possesses a nucleotide-binding domain that recognizes and positions UDP-linked substrates

    • The enzyme contains a catalytic site that facilitates the specific transformation of its substrate to UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose

  • Substrate specificity determinants:

    • Binding pocket residues that recognize the specific features of the UDP-sugar substrate

    • Catalytic residues precisely positioned to enable the chemical transformation

  • Proposed catalytic mechanism:

    • Based on homology searches and biochemical characterization, CapD likely catalyzes a dehydration and/or isomerization reaction

    • The reaction requires specific positioning of the substrate to enable the selective modification at C-4 position

  • Structural basis for regulation:

    • The structure likely explains why CapD lacks phosphorylation sites targeted by the CapA1B1 tyrosine kinase complex

    • Potential allosteric sites that may respond to metabolic intermediates or other cellular signals

For researchers interested in detailed structural analysis, techniques such as X-ray crystallography, cryo-electron microscopy, or computational modeling would be essential next steps to elucidate the precise structural features that enable CapD's specific catalytic function.

What challenges exist in studying CapD-mediated reactions and how can they be overcome?

Researchers face several technical challenges when studying CapD-mediated reactions:

  • Protein stability and solubility issues:

    • Challenge: Recombinant CapD may exhibit limited stability or solubility

    • Solution: Optimize expression conditions (temperature, induction parameters), use solubility tags, or test different buffer compositions with stabilizing agents

  • Complex substrate synthesis:

    • Challenge: The UDP-linked substrates may be difficult to obtain commercially

    • Solution: Develop enzymatic or chemoenzymatic synthesis routes for substrate preparation, or establish collaboration with chemical synthesis specialists

  • Product detection and quantification:

    • Challenge: The reaction products may be difficult to detect or quantify accurately

    • Solution: Implement sensitive analytical methods like CE-MS that have been successfully used in previous studies

  • Integrating with other pathway components:

    • Challenge: Understanding how CapD functions within the complete biosynthetic pathway

    • Solution: Develop reconstitution systems that include multiple enzymes to study pathway flux and regulation, as demonstrated in studies that reconstituted sequential steps of CP synthesis

  • In vivo relevance of in vitro findings:

    • Challenge: Translating biochemical observations to cellular context

    • Solution: Complement in vitro studies with genetic approaches (gene deletion, site-directed mutagenesis) and cellular assays to validate the physiological significance of biochemical findings

Researchers have successfully addressed many of these challenges through careful experimental design and the combination of multiple analytical approaches, as demonstrated in studies that have characterized CapD's enzymatic activity and its place in the CP biosynthetic pathway .

What are the optimal conditions for heterologous expression and purification of recombinant CapD?

Successful expression and purification of functional recombinant CapD requires careful optimization of several parameters:

  • Expression system selection:

    • E. coli BL21(DE3) strain is commonly used for cytoplasmic proteins

    • Consider codon optimization for the S. aureus sequence to improve expression levels

    • Test multiple affinity tags (His6, GST, MBP) for optimal solubility and activity

  • Expression conditions optimization:

    ParameterOptimization RangeNotes
    Induction temperature15-30°CLower temperatures often improve solubility
    IPTG concentration0.1-1.0 mMTitrate to find optimal induction level
    Expression duration4-24 hoursBalance protein yield with aggregation risk
    Media compositionLB, TB, auto-inductionRich media may improve yields
  • Purification strategy:

    • Initial capture: Affinity chromatography (typically IMAC for His-tagged protein)

    • Intermediate purification: Ion exchange chromatography to remove contaminants

    • Polishing: Size exclusion chromatography to ensure homogeneity

    • Buffer optimization: Include stabilizing agents (glycerol, reducing agents) to maintain enzyme activity

  • Activity verification:

    • Develop an activity assay to verify that purified protein retains enzymatic function

    • Screen different storage conditions to maximize stability for downstream experiments

Successful purification has been reported in previous studies, where CapD was obtained in sufficient quantity and purity for detailed biochemical characterization including substrate specificity and kinetic analysis .

How can researchers integrate CapD studies with other CP biosynthesis enzymes to understand pathway regulation?

To understand the integrated regulation of CP biosynthesis, researchers should consider a multi-enzyme reconstitution approach:

  • Sequential enzyme cascade reconstitution:

    • Purify multiple enzymes in the pathway (CapD, CapN, CapM, CapL, CapI)

    • Reconstitute sequential reactions to observe product formation and identify rate-limiting steps

    • This approach has been successfully implemented to trace the formation of lipid-linked CP precursors (lipid I cap, lipid II cap, lipid III cap)

  • Regulatory enzyme inclusion:

    • Incorporate the CapA1B1 tyrosine kinase complex to study phosphorylation-dependent regulation

    • Include the CapC1/C2 phosphatases to examine reversible phosphorylation dynamics

    • Test how these regulatory proteins affect flux through the pathway

  • Analytical techniques for multi-enzyme systems:

    • Use thin-layer chromatography (TLC) to monitor lipid-linked intermediates

    • Apply mass spectrometry for precise identification of reaction products

    • Employ radioisotope labeling (e.g., 14C-labeled precursors) to track specific conversion steps

  • Data integration and pathway modeling:

    • Collect kinetic parameters for individual enzymes and reaction steps

    • Develop mathematical models to predict pathway behavior under different conditions

    • Validate models with experimental data from the reconstituted system

This integrated approach has revealed important insights, including the identification of critical enzymatic checkpoints controlled by the CapA1B1 complex and the finding that CapD is not subject to tyrosine phosphorylation, unlike other enzymes in the pathway .

What are the current techniques for studying the interaction between CP biosynthesis and cell wall assembly?

Studying the interaction between capsular polysaccharide biosynthesis and cell wall assembly requires specialized techniques to examine these interconnected processes:

  • Dual-labeled precursor tracking:

    • Utilize differentially labeled precursors for CP and peptidoglycan synthesis

    • Track the fate of these precursors using microscopy and biochemical approaches

    • Quantify the distribution of common precursors (e.g., undecaprenyl-phosphate) between pathways

  • Membrane fraction reconstitution:

    • Isolate bacterial membrane fractions containing both CP and cell wall synthesis machinery

    • Supplement with purified components to reconstitute specific aspects of each pathway

    • Observe how modulation of one pathway affects the other

  • Protein-protein interaction studies:

    • Apply techniques such as co-immunoprecipitation, bacterial two-hybrid, or FRET to identify interactions between CP and cell wall synthesis proteins

    • Use surface plasmon resonance or microscale thermophoresis to quantify binding affinities

    • The interaction between LcpC (a member of the LytR-CpsA-Psr protein family) and peptidoglycan precursor lipid II demonstrates one such connection

  • Regulatory kinase studies:

    • Investigate how the Ser/Thr kinase PknB senses cellular lipid II levels to negatively control CP synthesis

    • Examine how the CapA1B1 tyrosine kinase complex modulates the consumption of shared precursors

  • Advanced microscopy techniques:

    • Use super-resolution microscopy to visualize the spatial organization of CP and cell wall synthesis machinery

    • Apply correlative light and electron microscopy to examine these processes at different scales

These approaches have revealed important insights, including how CapA activator protein cleaves lipid-linked CP precursors to release the essential lipid carrier undecaprenyl-phosphate, and how LcpC attaches CP using peptidoglycan precursor lipid II as an acceptor substrate .

What emerging technologies could advance our understanding of CapD function?

Several cutting-edge technologies hold promise for deepening our understanding of CapD function:

These technologies would complement the established biochemical approaches that have already yielded important insights into CapD function, such as its role in synthesizing UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose as a precursor for UDP-d-FucNAc .

How might targeting CapD facilitate development of novel antimicrobial strategies?

Targeting CapD presents several promising avenues for antimicrobial development:

  • Rationale for targeting CapD:

    • CapD catalyzes an essential early step in CP biosynthesis

    • Inhibition would disrupt capsule formation, potentially reducing bacterial virulence

    • The enzyme's structure and catalytic mechanism likely differ from human enzymes, offering selectivity

  • Potential inhibitor development strategies:

    ApproachTarget SitePotential Advantages
    Substrate analogsActive siteDirect competition with natural substrate
    Transition state mimicsCatalytic centerHigh-affinity binding
    Allosteric inhibitorsRegulatory sitesMay overcome resistance mechanisms
    Covalent inhibitorsCatalytic residuesProlonged inhibition
  • Screening approaches:

    • Develop high-throughput enzymatic assays for inhibitor screening

    • Use fragment-based drug discovery to identify initial chemical matter

    • Apply structure-based design once detailed structural information is available

  • Combination strategies:

    • Target multiple enzymes in the CP biosynthesis pathway (e.g., CapD and CapN)

    • Combine CP synthesis inhibitors with cell wall-targeting antibiotics

    • Target the coordination between CP synthesis and cell wall assembly

  • Potential advantages as an antimicrobial target:

    • Inhibition may reduce virulence without directly killing bacteria, potentially reducing selection pressure for resistance

    • The unique coordination between CP biosynthesis and cell wall assembly offers novel intervention points

    • Targeting a virulence factor rather than essential processes may provide new options for difficult-to-treat infections

Researchers have demonstrated the integration of CP biosynthesis into the multi-component Gram-positive cell wall biosynthetic machinery, suggesting that disrupting this coordination could be a valuable therapeutic approach .

What are common issues in CapD enzymatic assays and how can they be resolved?

Researchers working with CapD enzymatic assays often encounter several technical challenges:

  • Low enzymatic activity:

    • Issue: Purified CapD shows minimal or no detectable activity

    • Solutions:

      • Verify protein folding using circular dichroism

      • Test different buffer compositions and pH ranges

      • Add potential cofactors (metals, coenzymes)

      • Check for inhibitory compounds in buffer components

  • Product detection limitations:

    • Issue: Difficulty detecting or quantifying the UDP-2-acetamido-2,6-dideoxy-d-xylo-4-hexulose product

    • Solutions:

      • Optimize capillary electrophoresis conditions for better separation

      • Develop more sensitive mass spectrometry methods

      • Consider derivatization strategies to enhance detection

      • Implement coupled enzyme assays where CapD product serves as substrate for a more easily monitored reaction

  • Substrate availability:

    • Issue: Limited access to the UDP-linked substrate

    • Solutions:

      • Develop enzymatic synthesis methods using upstream enzymes

      • Establish collaboration with chemical synthesis specialists

      • Consider commercial custom synthesis options

  • Enzyme stability during assay:

    • Issue: Rapid loss of activity during assay conditions

    • Solutions:

      • Include stabilizing agents (glycerol, BSA, reducing agents)

      • Optimize temperature conditions

      • Test different storage buffers and conditions

      • Consider fusion tags that enhance stability

  • Inconsistent results between batches:

    • Issue: Variable activity between different preparations

    • Solutions:

      • Standardize expression and purification protocols

      • Develop quantitative activity assays for quality control

      • Establish internal standards for normalization

      • Consider single-batch production and aliquoting for long-term studies

Researchers have successfully addressed many of these challenges through careful optimization of experimental conditions, as demonstrated in studies that characterized CapD's enzymatic activity using capillary electrophoresis and mass spectrometry .

How can researchers validate that recombinant CapD is functionally equivalent to the native enzyme?

Validating the functional equivalence of recombinant and native CapD is essential for ensuring research relevance:

  • Enzymatic activity comparison:

    • Isolate membrane fractions from S. aureus containing native CapD

    • Compare kinetic parameters (Km, kcat) between native and recombinant enzyme

    • Evaluate substrate specificity profiles across multiple potential substrates

  • Structural integrity assessment:

    • Use limited proteolysis to compare folding patterns

    • Apply circular dichroism to compare secondary structure elements

    • If available, compare crystal structures or structural models

  • Post-translational modification analysis:

    • Use mass spectrometry to identify potential modifications in the native enzyme

    • Assess whether these modifications affect activity

    • Consider recreating important modifications in the recombinant protein

  • Complementation studies:

    • Generate S. aureus CapD deletion mutants

    • Complement with wild-type or recombinant CapD variants

    • Assess restoration of capsule production and related phenotypes

  • Integration with pathway components:

    • Test interaction with other CP biosynthesis proteins

    • Verify that recombinant CapD functions properly in reconstituted multi-enzyme systems

    • Confirm that regulatory mechanisms (e.g., feedback inhibition) function normally

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.