Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
cpsC; SAG1173; Capsular polysaccharide biosynthesis protein CpsC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Target Names
cpsC
Target Protein Sequence
MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVIN PNTPNNSITAQDLQAGSFLANDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKD TRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDITTLEKGNLPKAPSSPNIKKN VLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKVLGLTSLGIVPDLNKL
Uniprot No.

Target Background

Function

Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC) is required for CpsD phosphorylation. It plays a regulatory role in capsular polysaccharide biosynthesis and may be part of a complex coordinating the polymerization and cell surface export of the capsular polysaccharide.

Database Links

KEGG: sag:SAG1173

Protein Families
CpsC/CapA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of CpsC and how does it relate to its function?

CpsC is a transmembrane protein with a critical cytoplasmic C-terminal end that plays a key role in capsular polysaccharide (CPS) biosynthesis. Research has demonstrated that this C-terminal domain is essential for protein-protein interactions with CpsD, enabling CpsD autophosphorylation and proper localization at the division site .

The functional architecture of CpsC includes:

  • N-terminal transmembrane domain anchoring it to the bacterial membrane

  • Cytoplasmic C-terminal domain that interacts with CpsD

  • Middle region that may participate in stabilizing protein complex formation

To study CpsC structure experimentally, researchers typically employ truncation mutants (like cpsC-ΔCter) that demonstrate the importance of specific domains for function . Fluorescence microscopy using tagged versions of CpsC can reveal its cellular localization and interaction with other capsular proteins.

How does CpsC contribute to capsular polysaccharide attachment to the cell wall?

The current model suggests CpsC participates in a sequential interaction pathway where:

  • CpsC first captures CpsD at the division septum

  • This complex then enables localization of the polysaccharide polymerase CpsH

  • Together, these proteins orchestrate proper CPS production and cell wall attachment

Methodologically, researchers can evaluate CPS attachment by quantifying cell wall-associated CPS (CW-CPS) versus total CPS produced. Mutations affecting attachment show normal total CPS but decreased cell wall-bound fraction . Importantly, proper CPS attachment is critical for virulence, as mutants with defective attachment are unable to cause bacteremia despite producing wild-type levels of CPS .

What experimental approaches best characterize the interaction between CpsC and CpsD?

Several complementary methods provide insight into CpsC-CpsD interactions:

  • Fluorescence microscopy: Co-localization studies using fluorescently tagged CpsC and CpsD demonstrate that CpsC is required for proper CpsD localization at the division septum .

  • Phosphorylation assays: Since CpsC activates CpsD autophosphorylation, detecting phosphorylated CpsD (CpsD~P) via western blot with anti-phosphotyrosine antibodies provides indirect evidence of functional interaction.

  • Co-immunoprecipitation: Pulling down CpsC complexes and identifying CpsD via immunoblotting confirms physical interaction.

  • Bacterial two-hybrid systems: These can be employed to map specific interaction domains between the proteins.

  • Truncation and point mutation studies: Research shows that deletion of CpsC's C-terminal domain prevents CpsD phosphorylation and disrupts localization, providing strong evidence for direct interaction through this region .

For recombinant protein studies, researchers should consider co-expressing both proteins or using the C-terminal domain of CpsC fused to a soluble tag to evaluate binding affinity quantitatively through surface plasmon resonance or isothermal titration calorimetry.

How does CpsD phosphorylation status influence the function of the CpsC-CpsD complex?

The phosphorylation state of CpsD serves as a molecular switch regulating CPS production and attachment:

  • Non-phosphorylated CpsD: Promotes maximal CPS biosynthesis/polymerization when in complex with CpsC

  • Phosphorylated CpsD (CpsD~P): Redirects activity toward CPS transfer and attachment to the cell wall

The regulatory cycle appears to work as follows:

  • CpsC and non-phosphorylated CpsD interact, promoting ATP binding to CpsD

  • This facilitates interaction with polymerases, maximizing CPS synthesis

  • CpsD phosphorylation alters these interactions, slowing polymerization

  • This shift promotes transfer of CPS polymer to cell wall attachment machinery

  • CpsB dephosphorylates CpsD~P, restarting the cycle

To experimentally manipulate this system, researchers can use phosphomimetic mutations (e.g., tyrosine to glutamate) or non-phosphorylatable mutations (tyrosine to phenylalanine) in CpsD to assess the impact of phosphorylation state on complex function.

What expression systems are most effective for producing functional recombinant CpsC?

Producing functional recombinant CpsC presents challenges due to its transmembrane nature. The following approaches have proven most successful:

Prokaryotic expression systems:

  • E. coli with specialized membrane protein expression strains (C41/C43)

  • Use of fusion partners that enhance membrane insertion (e.g., MBP, SUMO)

  • Codon optimization for bacterial expression

  • Induction at lower temperatures (16-20°C) to facilitate proper folding

Cell-free expression systems:

  • Particularly useful when combined with nanodiscs or liposomes for membrane protein integration

  • Allow direct incorporation into artificial membrane environments

For researchers interested in only the cytoplasmic domain function, expressing just the C-terminal portion as a soluble protein is often more practical. This approach enables structural studies and interaction assays while avoiding the challenges of full-length membrane protein expression.

When designing constructs, consider:

  • Adding a cleavable purification tag (His6, GST) for affinity purification

  • Including fluorescent tags for localization studies if function is not compromised

  • Using a vector with tightly controlled expression to prevent toxicity

Validation of properly folded protein can be performed using circular dichroism spectroscopy for secondary structure assessment.

What are the key considerations for functional assays with recombinant CpsC?

When designing functional assays for recombinant CpsC, researchers should consider:

  • Reconstitution environment: As a transmembrane protein, CpsC requires a membrane-like environment for native function. Options include:

    • Detergent micelles (mild detergents like DDM or LMNG)

    • Nanodiscs or liposomes for more native-like membrane mimics

    • Whole-cell assays in heterologous hosts

  • Partner proteins: CpsC functions in complex with CpsD and influences CpsH localization. Key assays include:

    • CpsD phosphorylation assays (measuring ATP consumption or phosphotyrosine formation)

    • CpsH recruitment assays using fluorescently tagged proteins

    • CPS polymerization assays with reconstituted complexes

  • Mutation analysis: Complementation studies with mutant versions can reveal structure-function relationships:

    • C-terminal truncations disrupt CpsD interaction and phosphorylation

    • Point mutations can identify specific residues involved in protein-protein interactions

  • Quantification methods:

    • Western blotting with phospho-specific antibodies to monitor CpsD phosphorylation

    • Microscopy-based approaches to assess protein localization

    • Biochemical assays measuring CPS production and attachment to cell wall

How can researchers distinguish between direct and indirect effects of CpsC mutations on capsule biosynthesis?

Distinguishing direct from indirect effects requires a multi-faceted experimental approach:

  • Genetic complementation studies:

    • Wild-type complementation should restore normal phenotype

    • Domain-specific or point mutations can pinpoint functional regions

    • Chimeric proteins with domains from related species can identify conserved functional elements

  • Biochemical interaction mapping:

    • In vitro reconstitution with purified components

    • Systematic analysis of protein-protein interactions using techniques like hydrogen-deuterium exchange mass spectrometry

    • Surface plasmon resonance or microscale thermophoresis to quantify binding affinities and kinetics

  • Cellular localization studies:

    • Super-resolution microscopy to visualize protein complex formation in vivo

    • Correlative light and electron microscopy to examine ultrastructural effects on capsule architecture

    • FRET/BRET approaches to detect protein proximity in living cells

  • Temporal analysis:

    • Inducible expression systems to monitor immediate versus delayed effects

    • Time-lapse microscopy to track protein localization and capsule formation dynamics

Research data demonstrates that CpsC mutations affecting the C-terminal domain prevent CpsD localization and phosphorylation, while also disrupting CpsH localization . This sequential effect pattern (CpsC → CpsD → CpsH) provides evidence for direct rather than pleiotropic effects within this pathway.

What approaches can resolve contradictory findings regarding CpsC/CpsD function in capsule regulation?

The literature contains some apparently contradictory findings regarding CpsC/CpsD function. For example, while some research indicates that high levels of phosphorylated CpsD result in decreased total CPS biosynthesis, other studies suggest increased CPS production in cpsB deletion mutants (which have elevated CpsD~P levels) . To resolve such contradictions:

  • Distinguish measurement methodologies:

    • Total CPS versus cell wall-attached CPS measurements give different results

    • Growth conditions significantly impact results (solid media vs. liquid culture)

    • Different serotypes may exhibit strain-specific regulatory mechanisms

  • Consider environmental influences:

    • Oxygen concentration affects CpsD phosphorylation levels

    • Growth phase impacts capsule production

    • Media composition alters regulatory patterns

  • Employ integrative approaches:

    • Combine genetic, biochemical, and microscopy-based methods

    • Use quantitative rather than qualitative assessments

    • Standardize experimental conditions across studies

  • Apply statistical design of experiments:

    • Use Central Composite Design (CCD) to evaluate multiple factors simultaneously

    • This approach can reveal complex interactions between variables that may explain contradictory findings

How does CpsC coordinate capsule biosynthesis with cell division processes?

CpsC plays a central role in coordinating capsule biosynthesis with cell division through:

  • Spatial regulation: CpsC localizes at the division septum and recruits CpsD to this site . This localization ensures that:

    • Capsule biosynthesis occurs specifically at the division site

    • Newly formed daughter cells receive proper capsule coverage

    • Cell wall synthesis and capsule attachment are coordinated

  • Temporal control: The phosphorylation cycle of CpsD, mediated by CpsC, appears to synchronize capsule production with the cell cycle:

    • Defects in CpsD phosphorylation lead to:

      • Aberrant cell elongation

      • Multiple non-constricted septa

      • Nucleoid segregation defects

  • Coordination with chromosome segregation:

    • CpsD shares structural homology with ParA-like ATPases involved in chromosome partitioning

    • CpsD interacts with the chromosome partitioning protein ParB

    • CpsD phosphorylation modulates ParB mobility

These findings suggest a sophisticated regulatory network where CpsC-mediated control of CpsD phosphorylation coordinates capsule synthesis with chromosome segregation and cell division.

ProteinLocalizationFunction in DivisionEffect when Mutated
CpsCDivision septumRecruits CpsD; enables CpsH localizationMislocalized capsule; no septal CPS
CpsDDivision septum (CpsC-dependent)Coordinates capsule synthesis with division; interacts with ParBCell elongation; nucleoid defects; division abnormalities
CpsHDivision septum (CpsC/CpsD-dependent)Polymerizes capsular polysaccharideReduced polymerization of CPS

Methodologically, researchers can investigate these coordination mechanisms using fluorescently tagged proteins and time-lapse microscopy to track the dynamic localization of these components throughout the cell cycle.

What experimental strategies can elucidate the relationship between CpsC function and chromosome segregation?

Given the structural similarities between CpsD and ParA-like proteins, and the interaction between CpsD and ParB, several experimental approaches can explore how CpsC (through CpsD) influences chromosome segregation:

  • High-resolution localization studies:

    • 3D-Structured Illumination Microscopy (3D-SIM) to visualize spatial relationships between CpsC, CpsD, ParB, and nucleoids

    • Total Internal Reflection Fluorescence (TIRF) microscopy to examine protein dynamics at the membrane

    • Single-particle tracking of fluorescently labeled proteins to measure mobility changes

  • Chromosome dynamics analysis:

    • Fluorescent repressor operator system (FROS) to track specific chromosomal loci

    • HiC or chromosome conformation capture techniques to detect altered chromosome organization

    • DAPI staining combined with flow cytometry to quantify DNA content and replication status

  • Biochemical interaction studies:

    • Pull-down assays to identify components of the CpsC-CpsD-ParB complex

    • ChIP-seq to determine if CpsD associates with specific chromosomal regions

    • In vitro reconstitution of the segregation apparatus with purified components

  • Genetic approaches:

    • Synthetic lethal screens to identify genetic interactions between capsule and segregation genes

    • Suppressor screens to identify compensatory mutations that restore normal phenotypes

    • Conditional depletion systems to study the immediate effects of protein loss

Studies using phosphorylation-defective CpsD variants reveal phenotypes consistent with chromosome segregation defects, including aberrant nucleoid morphology and cell elongation . These observations support a model where the CpsC-controlled phosphorylation state of CpsD serves as a signaling system coordinating capsule synthesis with chromosome segregation.

How does the STK signaling pathway intersect with CpsC-mediated capsule regulation?

Recent research has identified significant crosstalk between serine/threonine kinase (STK) signaling and the CpsC-mediated capsule biosynthesis pathway:

  • STK contributions to capsule regulation:

    • STKs (such as Stk1) can regulate CPS synthesis, though the mechanisms have been unclear

    • The protein CcpS is phosphorylated by Stk1 and modulates CpsB phosphatase activity in Streptococcus suis

    • This creates a regulatory link between STK signaling and the CpsBCD phosphoregulatory system

  • Integrated regulatory model:

    • STK signaling may respond to environmental cues or stresses

    • This information is transmitted via phosphorylation of CcpS

    • Modified CcpS influences CpsB activity

    • CpsB activity determines CpsD phosphorylation levels

    • CpsD phosphorylation state, influenced by CpsC, controls capsule production and attachment

  • Experimental approaches to study this integration:

    • Phosphoproteomic analysis to identify all phosphorylated proteins in these pathways

    • Epistasis analysis using genetic knockouts in various combinations

    • In vitro reconstitution with purified components to measure enzymatic activities

    • Structural studies of protein complexes to understand physical interactions

This multi-level regulation allows bacteria to fine-tune capsule production in response to diverse environmental conditions. Understanding these interconnected pathways may reveal new therapeutic targets for disrupting capsule formation in pathogenic bacteria.

What metabolic cues influence CpsC function, and how can these be experimentally manipulated?

The CpsC-CpsD regulatory system responds to various metabolic signals that help bacteria adjust capsule production to environmental conditions:

  • Known metabolic influences:

    • Oxygen concentration: Decreased environmental oxygen levels increase both CPS production and CpsD phosphorylation levels

    • Energy status: ATP availability affects CpsD autophosphorylation

    • Growth phase: Transition from exponential to stationary phase alters capsule regulation

  • Experimental approaches to manipulate these cues:

    • Controlled atmosphere chambers to manipulate oxygen levels

    • Metabolic inhibitors to alter ATP availability

    • Carbon source variation to change metabolic flux

    • Temperature shifts to induce stress responses

  • Measurement methods:

    • Real-time monitoring of CpsD phosphorylation with phospho-specific antibodies

    • Quantification of capsule production under varied conditions

    • Metabolomic profiling to correlate metabolic state with capsule regulation

    • Transcriptomic analysis to identify metabolically-responsive gene expression patterns

  • Advanced analytical approach: Central Composite Design:

    • This statistical technique from response surface methodology allows efficient estimation of main effects, interaction effects, and quadratic effects of multiple factors simultaneously

    • CCD is particularly useful for process optimization when the relationship between variables is not linear

    • For CpsC research, CCD can help identify optimal conditions for recombinant protein production or determine the combined effects of multiple metabolic variables on CpsC function

Understanding these metabolic influences provides insights into how bacteria modulate virulence in response to host environments and may suggest novel therapeutic strategies targeting metabolic vulnerability points.

What emerging technologies can advance our understanding of CpsC structure and function?

Several cutting-edge technologies show promise for deeper insights into CpsC biology:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure determination

    • Cryo-electron tomography to visualize CpsC in its native membrane environment

    • Visualizing the full CpsB-CpsC-CpsD-CpsH complex architecture

  • Advanced protein engineering:

    • Nanobody development against specific CpsC epitopes for structural studies

    • Split fluorescent protein systems to detect conformational changes during activation

    • Optogenetic control of CpsC function to manipulate capsule synthesis with light

  • Single-molecule techniques:

    • FRET sensors to detect CpsC-CpsD interactions in real-time

    • Optical tweezers to measure mechanical forces during capsule assembly

    • Single-molecule tracking to follow individual CpsC molecules during cell division

  • Systems biology approaches:

    • Multi-omics integration to comprehensively map the capsule regulatory network

    • Machine learning analysis of large-scale phenotypic data

    • Genome-wide CRISPRi screens to identify novel genetic interactions with CpsC

  • Computational methods:

    • Molecular dynamics simulations of CpsC membrane integration and protein interactions

    • AlphaFold2-based structure prediction combined with experimental validation

    • Virtual screening for small molecule modulators of CpsC function

These technologies can help resolve outstanding questions about how CpsC transmits signals across the membrane and coordinates the activities of multiple capsule biosynthesis proteins.

How can understanding CpsC function inform the development of novel anti-capsule therapeutic strategies?

Targeting capsule biosynthesis represents a promising approach for combating encapsulated bacterial pathogens:

  • Rationale for targeting CpsC:

    • Disrupting CpsC function impairs capsule attachment to the cell wall, which is essential for virulence

    • CpsC mutants produce capsule but fail to cause bacteremia in animal models

    • The CpsC-CpsD interface represents a potentially druggable protein-protein interaction site

  • Therapeutic strategies:

    • Small molecule inhibitors of CpsC-CpsD interaction

    • Peptide mimetics of the CpsC C-terminal domain that compete for CpsD binding

    • Compounds that alter CpsD phosphorylation state

    • Antibody-antibiotic conjugates targeting surface-exposed portions of CpsC

  • Screening approaches:

    • High-throughput in vitro assays measuring CpsD phosphorylation

    • Cell-based screens for compounds that reduce capsule attachment

    • Structure-based virtual screening against the CpsC-CpsD interface

    • Fragment-based drug discovery to identify chemical starting points

  • Advantages over conventional approaches:

    • Anti-virulence approach may apply less selective pressure than antibiotics

    • Potential for serotype-independent activity against multiple pneumococcal strains

    • Could be combined with antibiotics for enhanced efficacy

    • May render bacteria more susceptible to host immune clearance

Research using cpsC mutants demonstrates that bacteria without properly attached capsules are severely attenuated in invasive disease models despite producing normal amounts of CPS . This suggests that therapeutics disrupting CpsC function could significantly reduce virulence without directly killing bacteria, potentially reducing selective pressure for resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.