Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

Shipped with Ice Packs
In Stock

Description

Genetic and Biochemical Studies

Study FocusMethodologyOutcomeSource
bexB inactivationGene knockout in H. influenzaeComplete loss of surface polysaccharide; abolished serum resistance and virulence in rat models
Capsule locus detectionPCR validation across 134 strainsbexB reliably identified capsule-positive strains (98.75% concordance with bexA); detected partial/deleted loci missed by bexA primers
Recombinant expressionHeterologous production in E. coliFunctional BexB purified for antibody generation and structural studies

Comparative Analysis with Homologs

Protein (Organism)FunctionIdentity to BexB
KpsT (E. coli K1)Polysialic acid export46.7%
LipB (N. meningitidis)Capsule transport40.1%
Wzm (Mannheimia haemolytica)CPS exportStructural homology in ATP-binding domain

Biotechnological Uses

  • Vaccine Development: Recombinant BexB serves as an antigen for vaccines targeting H. influenzae type b .

  • Diagnostics: Used in PCR and microarray assays to differentiate encapsulated vs. non-encapsulated strains .

Expression Systems

Host SystemAdvantagesChallenges
E. coliHigh yield, cost-effectiveRequires refolding for functional activity
Mammalian cellsProper post-translational modificationsLow scalability
BaculovirusSuitable for large-scale productionTime-intensive optimization

Clinical and Evolutionary Significance

  • Encapsulated H. influenzae strains lacking functional BexB are avirulent, underscoring its role in pathogenesis .

  • Conservation of BexB-like transporters across Gram-negative pathogens (e.g., E. coli, Salmonella) highlights its potential as a broad-spectrum therapeutic target .

Future Directions

  • Structural resolution of BexB to elucidate its ATP hydrolysis mechanism.

  • Engineering thermostable variants for improved vaccine formulations.

  • Exploring BexB inhibitors as "antivirulence" agents to combat antibiotic-resistant strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
bexB; Capsule polysaccharide export inner-membrane protein BexB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Haemophilus influenzae
Target Names
bexB
Target Protein Sequence
MQYGDKTTFKQSLAIQGRVINALLMREIITRYGRQNIGFFWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAILVMIDWIDAPHDVFYMLIAWFLMAMFAFGLGLIICAIAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPAQAQSIALWFPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLLGLVMVKNFSKGVEPQ
Uniprot No.

Target Background

Function
BexB, in association with BexA, BexC, and BexD proteins, may form an ATP-driven capsule polysaccharide export apparatus.
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is bexB and what is its functional role in capsule formation?

BexB is a protein encoded by the bexB gene located within region I of the capsule (cap) locus in Haemophilus influenzae. The protein plays an essential role in capsule polysaccharide exportation across the bacterial inner membrane. Region I genes, including bexB, are conserved across all six capsular types (a-f) of H. influenzae. This conservation makes bexB particularly valuable for molecular detection systems. BexB functions as part of the ATP-binding cassette (ABC) transporter complex involved in exporting capsular polysaccharides from the cytoplasm to the cell surface, where they form the protective capsular layer critical for bacterial virulence and immune evasion .

How does bexB differ from bexA in terms of genetic stability and detection reliability?

  • Mutation vulnerability: BexA has been documented to have partial deletions in some strains, particularly in capsule-deficient variants that possess a single cap locus with a partially deleted bexA gene. These deletions prevent detection with standard PCR primers. In contrast, there are no reported bexB partial deletions analogous to those observed in bexA .

  • Detection sensitivity: PCR methods based on bexA alone fail to identify capsule-deficient variants because primer binding is compromised by deletions. The standard approach requires multiple PCRs (up to seven separate reactions) to detect individual capsule types alongside bexA testing .

  • Conservation across serotypes: While both genes show high conservation, bexB demonstrates greater structural integrity across strains, making it a more reliable detection target for molecular assays .

What nucleotide sequence patterns exist across bexB variants in different H. influenzae serotypes?

DNA sequence analyses have revealed two distinct bexB sequence groups based upon nucleotide identity:

  • Group 1: Contains type c, d, and b strains

  • Group 2: Contains type e and f strains

  • Type e strains: 5/666 bp variation (0.75%)

  • Type f strains: 3/666 bp variation (0.45%)

This limited sequence variation provides valuable information for evolutionary studies while still allowing for reliable primer design targeting conserved regions .

What experimental validation supports the use of bexB as a capsule locus marker?

The validation of bexB as a capsule locus marker has been established through multiple experimental approaches:

  • PCR validation with reference strains: When tested against well-characterized H. influenzae strains with known capsule status, bexB PCR methods correctly identified:

    • All four serotypeable strains (ATCC type a, c, and d strains and type b strain Eagan) as bexA and bexB positive

    • Two known capsule-deficient variants as bexA negative but bexB positive

    • Four strains known by genomic sequence analysis to lack the cap region as both bexA and bexB negative

  • Clinical isolate testing: Among 40 strains previously serotyped in clinical laboratories:

    • 35 were bexA and bexB positive, confirming serotyping results

    • 5 were bexA and bexB negative and lacked region II capsule-specific genes, revealing likely false-positive serotyping results

  • High-throughput validation: DNA hybridization-based microarray methods showed 98.75% and 97.5% concordance to PCR methods for bexA and bexB detection, respectively .

How can researchers differentiate between true nontypeable H. influenzae (NTHI) strains and capsule-deficient variants using bexB?

Differentiating between true NTHI strains and capsule-deficient variants is a critical challenge in H. influenzae research. The bexB-based approach provides a powerful solution through the following methodological framework:

  • Initial bexB screening:

    • bexB negative: Indicates likely true NTHI strain lacking the entire capsule locus

    • bexB positive: Indicates strain contains either complete or partial capsule locus

  • Secondary characterization for bexB-positive strains:

    • Test for bexA presence

    • Test for capsule type-specific genes (a-f)

    • Interpret results:

      • bexB(+)/bexA(+)/cap-specific(+): Complete capsule locus

      • bexB(+)/bexA(-)/cap-specific(+): Capsule-deficient variant with bexA mutation

      • bexB(+)/bexA(+)/cap-specific(-): Unusual variant requiring further investigation

  • Confirmatory testing:

    • Negative controls (pepN gene detection) ensure sample quality

    • Sequencing can confirm specific genetic arrangements in ambiguous cases

This approach significantly enhances discrimination between genetically distinct strain types while minimizing resource utilization compared to traditional methods requiring multiple PCR assays for each strain.

What potential limitations exist in bexB-based detection methods and how can researchers address them?

While bexB-based detection methods offer significant advantages, researchers should be aware of several important limitations:

Researchers can address these limitations through:

  • Using validated primer sets targeting conserved regions

  • Including appropriate positive and negative controls

  • Confirming ambiguous results with additional methods

  • Maintaining minimal passage histories for isolates

  • Developing multi-target detection systems for comprehensive strain characterization

How does bexB detection correlate with false-positive serotyping results in clinical laboratories?

Research has documented significant discrepancies between serotyping results and molecular detection methods, with bexB-based approaches revealing important limitations in traditional serotyping:

  • False-positive rates: In one study of 40 strains previously serotyped as positive in clinical laboratories, 5 (12.5%) were both bexA and bexB negative and lacked region II capsule-specific genes, strongly suggesting false-positive serotyping results .

  • Serotyping challenges: Multiple studies have documented poor sensitivity of serotyping to distinguish cap region-positive from cap region-negative H. influenzae strains, even in reference laboratories. The most common error appears to be positive serotype reactions for strains lacking the cap locus .

  • Clinical implications: False-positive serotyping can lead to:

    • Misclassification of strains in surveillance programs

    • Overestimation of vaccine failures

    • Inaccurate epidemiological data

    • Incorrect assumptions about strain virulence potential

This data underscores the importance of incorporating molecular methods like bexB PCR into diagnostic and surveillance protocols, particularly for isolates with unusual or clinically significant presentations, where accurate strain characterization is essential for appropriate interventions.

What is the relationship between bexB sequence conservation and evolutionary relationships among H. influenzae capsule types?

The sequence conservation patterns in bexB provide valuable insights into the evolutionary relationships among H. influenzae capsule types:

  • Distinct phylogenetic groupings: The segregation of bexB sequences into two major groups (type c/d/b vs. type e/f) mirrors evolutionary relationships observed with other genetic markers. This suggests that capsule type acquisition and diversification followed specific evolutionary pathways .

  • Intra-serotype conservation: The 100% nucleotide identity observed in bexB genes among type b strains suggests strong selective pressure to maintain specific sequence features in this clinically significant serotype. This extreme conservation contrasts with the minimal (but detectable) variation in types e and f .

  • Comparative evolution: The patterns of sequence conservation between bexA and bexB differ slightly:

    • bexA shows 100% conservation within types e and f

    • bexB shows 0.75% and 0.45% variation in types e and f, respectively

This suggests potentially different evolutionary constraints or selection pressures on these adjacent and functionally related genes .

  • Implications for horizontal gene transfer: The high conservation within serotype groups suggests limited horizontal transfer of capsule genes between serotypes, with evolution primarily occurring through point mutations within lineages .

These evolutionary patterns have important implications for primer design, molecular epidemiology studies, and understanding the population structure of H. influenzae.

What PCR assay designs have been validated for bexB detection across diverse H. influenzae strains?

Several PCR methodologies have been validated for reliable bexB detection across diverse H. influenzae strains:

  • Primer designs:

    • bexB.1F/bexB.1R: Produces an amplicon of 567 bp

    • bexB.FLF/bexB.FLR: Produces an amplicon of 760 bp

  • Multiplex PCR components for comprehensive strain characterization:

    • bexA primers (343 bp amplicon)

    • pepN primers as positive control (918 bp amplicon)

    • Capsule type-specific primers (various amplicon sizes)

  • PCR conditions:

    • Standard thermal cycling parameters have been established

    • Visualization typically via agarose gel electrophoresis

    • Controls should include:

      • Known bexB-positive strain (e.g., type b strain Eagan)

      • Known true NTHI strain (e.g., 86-028NP)

      • Known capsule-deficient variant

      • No template control

  • Validation metrics from published studies:

    • 100% concordance with known capsule status in reference strains

    • High reproducibility across different laboratories

    • Successful amplification from diverse clinical isolates

These validated PCR assays provide researchers with robust tools for accurate determination of capsule locus status in H. influenzae isolates, with minimal resource requirements compared to traditional serotyping or multi-target PCR approaches.

What high-throughput methodologies can be employed for bexB detection in large strain collections?

For large-scale studies involving numerous H. influenzae isolates, several high-throughput methodologies have been developed and validated:

  • DNA hybridization-based microarray:

    • Allows simultaneous testing of hundreds of strains

    • Shows excellent concordance with PCR methods:

      • 98.75% agreement for bexA detection

      • 97.5% agreement for bexB detection

    • Utilizes mixed bexB probes to account for sequence variation

    • Can be combined with additional genetic markers for comprehensive characterization

  • Real-time PCR:

    • Enables quantitative assessment and higher sensitivity

    • Reduces contamination risk through closed-tube format

    • Allows for multiplex detection with appropriate probe design

    • Significant time savings compared to conventional PCR

  • Next-generation sequencing approaches:

    • Whole genome sequencing provides comprehensive genetic characterization

    • Targeted amplicon sequencing can focus specifically on bexB and related loci

    • Allows detection of novel variants and mutations

    • Enables phylogenetic analysis of strains

MethodThroughputTime RequirementEquipment CostPer Sample CostAdditional Genetic Information
Conventional PCRLow-Medium4-5 hoursLowLowLimited to targeted genes
Real-time PCRMedium-High1-2 hoursMediumMediumLimited to targeted genes
MicroarrayHigh8-24 hoursHighMediumMultiple genetic markers
NGSHigh1-3 daysHighHighComprehensive genetic profile

These high-throughput methods provide researchers with scalable options for bexB detection based on their specific research needs, available resources, and desired level of genetic characterization.

How should researchers integrate bexB-based detection into comprehensive H. influenzae molecular surveillance systems?

Integration of bexB-based detection into comprehensive H. influenzae surveillance systems should follow a structured approach:

  • Initial strain classification:

    • Use bexB PCR as first-line screening to differentiate:

      • bexB-negative strains (true NTHI)

      • bexB-positive strains (containing complete or partial capsule locus)

  • Second-tier characterization for bexB-positive strains:

    • Test for bexA to identify potential capsule-deficient variants

    • Perform capsule type-specific PCRs (a-f) to determine serotype

    • This strategy minimizes resource utilization by focusing detailed testing on relevant strains

  • Integration with other molecular typing methods:

    • MLST (Multi-Locus Sequence Typing) for population structure

    • Antimicrobial resistance determinants (e.g., ftsI, pbp genes)

    • Virulence factor profiling

    • Whole genome sequencing for selected isolates

  • Standardized reporting framework:

    • Uniform nomenclature for strain classification

    • Consistent methodology across surveillance sites

    • Centralized data repository for trend analysis

    • Regular proficiency testing among participating laboratories

  • Correlation with clinical and epidemiological data:

    • Disease manifestation and severity

    • Patient demographics and risk factors

    • Vaccination status

    • Geographic and temporal distribution

This integrated approach leverages the simplicity and reliability of bexB-based detection while enabling comprehensive characterization of H. influenzae strains for effective surveillance and epidemiological monitoring.

What quality control measures should be implemented when using bexB as a marker for capsule typing?

Implementing robust quality control measures is essential when using bexB as a marker for capsule typing:

  • Reference strain controls:

    • Positive controls:

      • Serotype a-f reference strains (ATCC strains or equivalent)

      • Known capsule-deficient variants (e.g., bexA-negative, bexB-positive strains)

    • Negative controls:

      • True NTHI strains lacking the capsule locus (e.g., 86-028NP)

      • Non-H. influenzae species (e.g., H. haemolyticus)

    • Procedural controls:

      • No template control

      • Inhibition control (pepN amplification)

  • Primer validation:

    • Regular verification of primer performance with reference strains

    • Monitoring for potential sequence drift in primer binding regions

    • Maintaining multiple primer sets for confirmation of ambiguous results

  • Inter-laboratory standardization:

    • Participation in proficiency testing programs

    • Use of standardized protocols and reagents

    • Regular comparison of results with reference laboratories

  • Discrepancy resolution protocol:

    • For strains with unusual patterns (e.g., bexB+/bexA+/cap-specific-):

      • Repeat testing with alternative primers

      • Sequencing of relevant genetic regions

      • Whole genome sequencing for definitive characterization

  • Documentation and traceability:

    • Detailed record-keeping of strain histories

    • Monitoring for potential genetic changes during laboratory passage

    • Clear documentation of methodological details in publications

Implementation of these quality control measures ensures reliable and reproducible results when using bexB as a marker for capsule typing, facilitating accurate strain characterization for research, surveillance, and clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.