Recombinant Carassius auratus Alpha-2 adrenergic receptor

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Alpha-2 adrenergic receptor; Alpha-2 adrenoreceptor; Alpha-2 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Carassius auratus (Goldfish)
Target Protein Sequence
MDVTQSNATKDDANITVTPWPYTETAAAFIILVVSVIILVSIVGNVLVIVAVLTSRALRA PQNLFLVSLACADILVATLVIPFSLANEIMGYWFFGSTWCAFYLALDVLFCTSSIVHLCA ISLDRYWSVTKAVSYNLKRTPKRIKSMIAVVWVISAVISFPPLIMTKHDEKECLINDETW YILSSSLVSFFAPGFIMITVYCKIYRVAKQRSSTVFVAKNGLERQPSQSETCFVRKDKFE KESPSSNSSESNQRQEELDDIDLEESATSDNKPKSSRFSNRRRVDGARCCPQRTCRISWV SSQEQSSKQLAVASKTKVAQMREKRFTFVLTVVMGVFVLCWFPFFFTYSLHAICGDSCEP PEALFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKICLLDCAAHLRDSCLGTLGRLNAK CIFECHQKSNQEETAN
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the primary structural characteristics of Carassius auratus alpha-2 adrenergic receptors?

Alpha-2 adrenergic receptors in goldfish, like their mammalian counterparts, belong to the G-protein coupled receptor (GPCR) superfamily characterized by seven transmembrane domains. These receptors couple primarily to inhibitory G proteins (Gi/o) and mediate various physiological responses including regulation of neurotransmitter release and vascular tone. While specific structural data on goldfish alpha-2 adrenergic receptors remains limited, comparative analysis with other teleost species suggests conservation of key binding domains. The goldfish olfactory epithelium transcriptome analysis has identified multiple G-protein coupled receptors, suggesting potential presence of various adrenergic receptor subtypes . Research approaches should include sequence alignment with well-characterized human receptors to identify conserved and divergent domains that may affect ligand binding and signaling properties.

How do expression patterns of alpha-2 adrenergic receptors differ across goldfish tissues?

Alpha-2 adrenergic receptors show tissue-specific expression patterns in goldfish, with significant presence in neural tissues, vascular tissues, and sensory organs. In the olfactory epithelium, these receptors may play roles in chemosensory signaling, as suggested by transcriptome analysis identifying multiple G-protein coupled receptors in this tissue . Distribution patterns appear to correlate with physiological functions - higher expression in tissues where catecholamine regulation is critical. For comprehensive tissue profiling, quantitative PCR remains the gold standard, with primers designed against conserved regions to detect potential subtypes. Immunohistochemistry can complement these approaches, though antibody specificity must be validated given the high sequence similarity between receptor subtypes and limited availability of goldfish-specific antibodies.

What expression systems are most suitable for recombinant goldfish alpha-2 adrenergic receptors?

Several expression systems have been evaluated for recombinant fish G-protein coupled receptors, each with distinct advantages:

Expression SystemAdvantagesLimitationsSpecial Considerations
Mammalian cell lines (CHO, HEK293)Post-translational modifications, membrane targetingTemperature adaptation neededLower incubation temperatures (25-28°C) improve folding
Fish cell linesNative-like lipid environment, temperature compatibilityLower expression yieldsPreferred for functional studies
Baculovirus-insect cellHigh expression levelsDifferent glycosylation patternsGood for structural studies
Yeast expression systemsCost-effective, scalableLimited post-translational modificationsRecommended for initial screening

Based on parallel studies with human alpha-2A adrenergic receptors, Chinese hamster lung (CHL) fibroblasts have shown success in expressing functional recombinant adrenergic receptors that maintain appropriate pharmacological characteristics . When selecting an expression system, researchers should consider whether their primary goal is structural characterization or functional analysis, as this will influence the optimal choice.

How should experiments be designed to detect synergistic interactions between alpha-2 and other adrenergic receptors in goldfish?

Detecting synergistic interactions requires carefully designed experiments that can distinguish between individual receptor contributions and combined effects. Based on findings with human alpha-2A receptors, there is evidence of synergistic interaction between endogenous alpha-1 and recombinant alpha-2A adrenoreceptors in certain expression systems . For goldfish receptors, consider the following experimental design approach:

  • Selective agonist/antagonist testing: Utilize selective compounds such as UK-14304 (alpha-2 agonist) and phenylephrine (alpha-1 agonist) individually and in combination to test for synergistic effects .

  • Calcium imaging assays: Employ calcium-sensitive dyes like Fluo3-AM with fluorometric imaging plate readers (FLIPR) to detect intracellular calcium changes following receptor activation .

  • G-protein coupling analysis: Use pertussis toxin pre-treatment to selectively inhibit Gi/o proteins coupled to alpha-2 receptors while preserving Gq/11 signaling from alpha-1 receptors .

  • Controls for endogenous receptor expression: Screen host cell lines for low-level expression of native adrenergic receptors that might confound results, as even minimal expression can contribute to synergistic effects .

  • Concentration-response curves: Generate full concentration-response curves for agonists alone and in combination to mathematically model synergistic effects.

In studies with human alpha-2A receptors, noradrenaline and A-54741 evoked calcium changes, with A-54741 acting as a partial agonist achieving only 33% of the noradrenaline maximum response . These responses were antagonized by both alpha-2 selective antagonist rauwolscine and alpha-1 selective antagonists prazosin and doxazosin, indicating receptor cross-talk .

What molecular techniques are most effective for creating and validating recombinant goldfish adrenergic receptors?

Based on successful approaches with other fish species, the following molecular techniques are recommended:

  • Gene cloning and vector construction:

    • PCR-amplify the full-length receptor gene from goldfish cDNA libraries

    • Add appropriate tags (His, FLAG) for detection and purification

    • Clone into expression vectors with strong promoters (CMV for mammalian cells)

  • Site-directed mutagenesis:

    • Use for creating specific receptor variants or for structure-function studies

    • QuikChange methodology is efficient for introducing point mutations

  • Homologous recombination:

    • Particularly useful for creating deletion mutants or fusion proteins

    • Has been successfully employed in other goldfish studies as demonstrated with CyHV-2 recombinant mutants

  • Validation techniques:

    • Western blotting with antibodies against receptor or epitope tags

    • Radioligand binding assays to confirm proper folding and ligand binding

    • Functional assays measuring changes in second messengers (cAMP, Ca²⁺)

    • Confocal microscopy to confirm membrane localization

  • Next-generation sequencing:

    • For validation of genetic constructs and detection of unintended mutations

    • Whole-genome sequencing confirmed successful gene targeting in CyHV-2 studies

The combined approach of nested-PCR and whole-genome sequencing used for validating CyHV-2 recombinant constructs provides a robust validation framework that can be adapted for goldfish receptor studies .

How can temperature-dependent effects be accounted for in goldfish alpha-2 adrenergic receptor studies?

As poikilothermic organisms, goldfish physiology is significantly influenced by environmental temperature, which affects receptor kinetics, membrane fluidity, and signaling pathways. Research designs must account for these effects through:

  • Temperature-controlled binding studies:

    • Conduct ligand binding assays at multiple temperatures (10°C, 20°C, 30°C)

    • Generate temperature-dependent binding profiles (Kd, Bmax values)

  • Temperature adaptation of expression systems:

    • Grow mammalian cells expressing goldfish receptors at lower temperatures (28°C)

    • Use fish cell lines when possible for more physiologically relevant conditions

  • Signaling kinetics analysis:

    • Measure time-course of receptor activation and desensitization at different temperatures

    • Account for temperature effects on enzyme kinetics in downstream pathways

  • Control experiments:

    • Include parallel studies with mammalian receptors for comparison

    • Normalize data to appropriate temperature-matched controls

  • Mathematical modeling:

    • Apply Arrhenius plots to characterize temperature dependence

    • Develop compensation factors for comparing data across temperatures

When interpreting results, researchers should consider that observed differences between fish and mammalian receptors may reflect temperature adaptation rather than intrinsic structural differences.

How should calcium imaging data from goldfish alpha-2 adrenergic receptor studies be analyzed?

Calcium imaging data for goldfish alpha-2 adrenergic receptors requires specific analytical approaches to account for the potential synergistic effects and temperature-dependent kinetics:

  • Baseline normalization:

    • Express fluorescence changes as F/F0 or ΔF/F0 (where F0 is baseline fluorescence)

    • Use rolling baseline correction for long recordings to account for photobleaching

  • Concentration-response analysis:

    • Generate full concentration-response curves using non-linear regression

    • Calculate EC50 values and compare with mammalian counterparts

    • For partial agonists like A-54741, express efficacy relative to full agonists (e.g., 33% of noradrenaline maximum)

  • Temporal analysis:

    • Characterize both peak amplitude and area under curve

    • Analyze response kinetics (time to peak, decay constants)

    • Be aware that fish receptors may show different kinetics compared to mammalian homologs

  • Statistical approach:

    • Apply appropriate statistical tests (ANOVA with post-hoc tests for multiple comparisons)

    • Use paired statistical tests when comparing responses in the same cells

    • For synergy studies, apply mathematical models of synergism (Bliss independence, Loewe additivity)

  • Control comparisons:

    • Compare responses to reference compounds with known pharmacology

    • Include positive controls (e.g., noradrenaline) in each experiment

    • Use selective antagonists like rauwolscine (alpha-2) and prazosin (alpha-1) to pharmacologically isolate receptor subtypes

In studies with human alpha-2A receptors, researchers found that calcium changes induced by noradrenaline and A-54741 were antagonized by both alpha-2 selective antagonist rauwolscine (10 nM) and alpha-1 selective antagonists prazosin (0.1 nM) and doxazosin (1.0 nM), indicating complex receptor interactions .

How can researchers differentiate between direct alpha-2 receptor effects and downstream pathway crosstalk?

Distinguishing direct receptor effects from downstream crosstalk is particularly challenging with goldfish alpha-2 adrenergic receptors due to potential synergistic interactions. Consider these approaches:

  • Selective G-protein inhibitors:

    • Use pertussis toxin to selectively inhibit Gi/o-mediated pathways

    • Studies with human alpha-2A receptors showed noradrenaline responses were abolished by pertussis toxin, confirming Gi/o involvement despite apparent alpha-1 receptor characteristics

  • siRNA knockdown experiments:

    • Selectively reduce expression of specific signaling components

    • Target various G-protein alpha subunits to determine coupling preferences

  • BRET/FRET proximity assays:

    • Use bioluminescence/fluorescence resonance energy transfer to directly measure receptor-G protein interactions

    • These techniques can detect immediate coupling events separate from downstream effects

  • Rapid kinetics analysis:

    • Compare time courses of different signaling events

    • Primary events occur faster than downstream crosstalk

  • Reconstitution experiments:

    • Express receptor with limited signaling components in artificial systems

    • Gradually add components to identify minimal requirements for specific responses

When interpreting results from human alpha-2A receptor studies, researchers found evidence suggesting co-activation of both recombinant alpha-2A receptors and endogenous alpha-1 receptors was necessary for calcium release, as selective agonists for either receptor alone had no effect but produced robust responses when combined .

What mechanisms underlie cross-talk between goldfish alpha-2 adrenergic receptors and other GPCR systems?

Cross-talk between goldfish alpha-2 adrenergic receptors and other GPCRs likely involves multiple mechanisms:

  • G-protein sharing and competition:

    • Different receptors may compete for limited G-protein pools

    • Activation of one receptor type can deplete available G-proteins for others

  • Beta-arrestin recruitment pathways:

    • Beta-arrestins serve as scaffolding proteins for multiple signaling pathways

    • Can mediate signaling convergence between different receptor systems

  • Downstream effector synergy:

    • Convergent signaling at adenylyl cyclase or phospholipase C

    • Combined effects on ion channels or transporters

  • Receptor heterodimerization:

    • Direct physical interaction between different receptor types

    • Can alter pharmacological properties and signaling preferences

  • Compartmentalization in membrane microdomains:

    • Co-localization of receptors in lipid rafts

    • Facilitates signaling complex formation

Evidence from studies with human alpha-2A adrenergic receptors in CHL fibroblasts demonstrated a synergistic interaction between endogenous alpha-1 and recombinant alpha-2A receptors that may have relevance to other cell types co-expressing these receptor subtypes . The observed synergy might explain how relatively low expression levels of native adrenergic receptors can significantly impact cellular responsiveness .

How do the pharmacological profiles of goldfish alpha-2 adrenergic receptor subtypes compare to mammalian orthologs?

The pharmacological profiles of goldfish alpha-2 adrenergic receptor subtypes likely show both conservation and divergence compared to mammalian orthologs:

PropertyGoldfish Alpha-2 ReceptorsMammalian Alpha-2 ReceptorsConsiderations for Research
Subtype diversityMultiple subtypes predicted based on transcriptome analysis Three subtypes (α2A, α2B, α2C) well-characterizedDesign experiments to identify and distinguish subtypes
Agonist potencyMay show altered potency hierarchyUK-14304, dexmedetomidine are potent agonists Test multiple concentrations spanning wide range
Temperature effectsFunction optimally at lower temperaturesOptimized for 37°CConduct assays at physiologically relevant temperatures
G-protein couplingPrimarily Gi/o but may show species-specific coupling preferencesPrimarily Gi/o with subtype-specific preferencesUse pertussis toxin to confirm Gi/o coupling
Desensitization kineticsPotentially slower at physiological temperaturesWell-characterized for each subtypeMonitor responses over extended time periods

When studying goldfish receptors, researchers should be aware that standard pharmacological tools developed for mammalian receptors may show altered potency, efficacy, or selectivity. For example, while studying human alpha-2A receptors, researchers found that of several tested agonists (UK-14304, B-HT 920, dexmedetomidine, A-54741, phenylephrine, and noradrenaline), only noradrenaline and A-54741 evoked calcium changes, with A-54741 acting as a partial agonist . This unexpected pharmacological profile highlights the importance of comprehensive characterization even when studying well-established receptor systems.

What role do alpha-2 adrenergic receptors play in goldfish olfactory signaling?

While direct evidence for alpha-2 adrenergic receptor function in goldfish olfactory signaling is limited, contextual information suggests several potential roles:

  • Modulation of olfactory sensitivity:

    • Alpha-2 receptors may regulate the gain of olfactory sensory neurons

    • Transcriptome analysis of goldfish olfactory epithelium revealed numerous G-protein coupled receptors, supporting complex neuromodulatory networks

  • Adaptation mechanisms:

    • May participate in olfactory adaptation to sustained stimuli

    • Could regulate calcium signaling during prolonged exposure to odorants

  • Developmental processes:

    • Potential involvement in olfactory neurogenesis and circuit formation

    • May influence expression of other olfactory receptors

  • Integration with hormonal signals:

    • Cross-talk with steroid and prostaglandin pheromone detection systems

    • Goldfish use steroids and prostaglandins as pheromone cues at different stages of the reproductive cycle

  • Neuronal excitability regulation:

    • Presynaptic inhibition of neurotransmitter release

    • Postsynaptic modulation of action potential generation

Research approaches should include immunohistochemical localization of alpha-2 receptors within the olfactory epithelium, calcium imaging in olfactory sensory neurons, and behavioral studies with selective agonists and antagonists. The goldfish olfactory epithelium transcriptome, with its identified G-protein coupled receptors, provides a valuable resource for identifying receptor candidates involved in olfactory processing .

What are the optimal protocols for heterologous expression and purification of goldfish alpha-2 adrenergic receptors?

Optimized protocols for heterologous expression and purification of goldfish alpha-2 adrenergic receptors should consider the following:

  • Expression system selection:

    • Mammalian cell lines (HEK293, CHO) maintain proper post-translational modifications

    • Chinese hamster lung (CHL) fibroblasts have demonstrated success with alpha-2A adrenergic receptors

    • Insect cell systems (Sf9, Hi5) yield higher protein quantities for structural studies

    • Lower temperature incubation (25-28°C) improves folding of fish proteins

  • Vector optimization:

    • Codon optimization for expression host

    • Strong promoters (CMV for mammalian cells)

    • Addition of N-terminal signal sequences to enhance membrane targeting

    • C-terminal tags (His, FLAG) for detection and purification

  • Culture conditions:

    • Temperature reduction to 28°C during expression phase

    • Addition of receptor ligands during expression to stabilize structure

    • Cholesterol supplementation to maintain membrane environment

  • Solubilization and purification:

    • Gentle detergents (DDM, LMNG) for membrane extraction

    • Lipid addition during purification to maintain stability

    • Affinity chromatography followed by size exclusion

    • Consider nanodiscs or SMALPs for maintaining native-like lipid environment

  • Quality control:

    • Radioligand binding to confirm functionality

    • Size exclusion chromatography to assess homogeneity

    • Western blotting to confirm size and integrity

Based on studies with human alpha-2A receptors, it's important to screen host cell lines for endogenous adrenergic receptors, as even low expression levels can influence experimental outcomes through synergistic effects .

How should calcium flux assays be optimized for goldfish alpha-2 adrenergic receptor studies?

Calcium flux assays require specific optimization for goldfish alpha-2 adrenergic receptors:

  • Dye selection and loading:

    • Fluo-3AM has been successfully used for adrenergic receptor studies in conjunction with fluorometric imaging plate readers (FLIPR)

    • Optimize dye concentration and loading time for fish cells

    • Include Pluronic F-127 to improve dye loading in fish cell membranes

    • Consider ratiometric dyes (Fura-2) for quantitative measurements

  • Buffer composition:

    • Adjust calcium concentration to physiological levels for fish (typically lower than mammals)

    • Consider temperature-appropriate pH buffering

    • Include glucose at concentrations appropriate for goldfish cells

  • Experimental parameters:

    • Conduct assays at appropriate temperature (20-25°C)

    • Adjust sampling frequency to capture potentially slower kinetics

    • Monitor responses for extended periods to detect delayed or prolonged signals

  • Controls and calibration:

    • Include positive controls (ionomycin) to determine maximum response

    • Use calcium-free conditions with EGTA to establish baseline

    • Perform in situ calibration with known calcium concentrations

  • Data analysis considerations:

    • Account for temperature effects on fluorophore properties

    • Be aware that response kinetics may differ from mammalian systems

    • Consider both peak amplitude and integrated response

Studies with human alpha-2A receptors found that only certain agonists (noradrenaline and A-54741) evoked calcium changes, while others (UK-14304, B-HT 920, dexmedetomidine) did not, highlighting the importance of testing multiple compounds .

What strategies can be employed to investigate potential synergistic interactions between goldfish alpha-1 and alpha-2 adrenergic receptors?

Based on findings with human receptors showing synergistic interactions between alpha-1 and alpha-2 adrenergic receptors , the following strategies are recommended:

  • Co-expression systems:

    • Create cell lines with controlled expression levels of both receptor types

    • Use inducible expression systems to vary receptor ratios

    • Tag receptors with different fluorescent proteins to monitor co-localization

  • Pharmacological approach:

    • Test selective agonists individually and in combination

    • Studies with human receptors found that phenylephrine (alpha-1 agonist) and UK-14304 (alpha-2 agonist) had no effect alone but produced robust calcium release when combined

    • Use selective antagonists at subttype-selective concentrations (rauwolscine for alpha-2, prazosin and doxazosin for alpha-1)

  • G-protein manipulation:

    • Selectively inhibit G-protein subtypes using pertussis toxin (Gi/o) or other tools

    • Human alpha-2A receptor responses to noradrenaline were abolished by pertussis toxin, confirming involvement of Gi/o proteins typically coupled to alpha-2 receptors

  • Signaling pathway dissection:

    • Monitor multiple downstream pathways simultaneously

    • Use pathway-specific inhibitors to identify convergence points

  • Mathematical modeling:

    • Apply synergy models (Bliss, Loewe) to quantify interactions

    • Develop kinetic models incorporating both receptor systems

  • Membrane microdomain disruption:

    • Use cholesterol-depleting agents to disrupt potential receptor co-localization

    • Assess impact on synergistic responses

Evidence from studies with human alpha-2A adrenergic receptors suggests that synergistic interactions between alpha receptor subtypes may have general importance in the control of cellular responsiveness and may explain how relatively low expression levels of native receptors can significantly impact experimental outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.