Recombinant Carassius auratus Neuronal acetylcholine receptor subunit beta-2 (chrnb2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant CHRNB2 is a ligand-gated ion channel subunit critical for neuronal signaling. In goldfish (Carassius auratus), this protein forms part of the heteropentameric nicotinic acetylcholine receptor (nAChR), which typically combines α and β subunits to regulate cation flux (e.g., Na⁺, K⁺, Ca²⁺) across cell membranes .

PropertySpecification
UniProt IDP19370
Gene Namechrnb2
Protein LengthFull-length (1-459 amino acids)
Molecular Weight~52 kDa (theoretical)
Host SystemEscherichia coli (E. coli)
TagN-terminal His tag
Purity>90% (SDS-PAGE)

Production and Purification

The protein is expressed in E. coli and purified under optimized conditions:

  • Expression Vector: Designed for high-yield production of full-length CHRNB2 .

  • Purification Method: Affinity chromatography leveraging the His tag .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) . Reconstitution in deionized water is recommended, with glycerol (5–50%) for long-term stability at -80°C .

Critical Notes:

  • Repeated freeze-thaw cycles degrade protein integrity .

  • Functional assays require reconstitution to 0.1–1.0 mg/mL .

Research Applications

Recombinant CHRNB2 is primarily used for:

  • Structural Studies: Investigating nAChR assembly and ligand interactions .

  • Drug Screening: Identifying agonists/antagonists targeting β2-containing receptors .

  • Antibody Development: Serving as an antigen for generating species-specific antibodies .

Limitations:

  • Lacks native glycosylation, potentially altering ligand-binding kinetics compared to mammalian systems .

  • Functional ion channel activity requires co-expression with α subunits (e.g., α4) .

Comparative Pharmacology

Studies on human CHRNB2 homologs reveal:

  • Agonist Sensitivity: Cytisine and nicotine show subtype-specific efficacy .

  • Antagonist Effects: Mecamylamine and dihydro-β-erythroidine inhibit β2-containing receptors .

LigandEffect on β2 SubunitsReference
AcetylcholineFull agonist (low potency)
NicotinePartial agonist
Dihydro-β-erythroidineCompetitive antagonist

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag type if feasible.
Synonyms
chrnb2; Neuronal acetylcholine receptor subunit beta-2; GF-beta-2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Carassius auratus (Goldfish)
Target Names
chrnb2
Target Protein Sequence
LRSDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWTDY RLVWDPNEYEGIKKLRIPSQHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAI YKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLVLTSDFASRDDYTPSGEWDIVSLPG RKNEDPNDLTYLDITYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKVTLCM SVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHY MPEWVKCVFLHKLPAFLLMRRPGRSNVRERFRRKHQRKSFSSHQDGDSFFLTDDPGRVCG AWRVGDLPEGSEFRQRVKVRHDQDVDEAIDGVRFIAEHMKIEDDDEGIIEDWKYVAMVID RLFLWIFILVCVVGTLGLFVQPLFQSYNTPVAEEVYGDF
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change ultimately leads to the opening of an ion-conducting channel across the plasma membrane.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Carassius auratus chrnb2?

Carassius auratus neuronal acetylcholine receptor subunit beta-2 (chrnb2) is a critical component of nicotinic acetylcholine receptors in the goldfish nervous system. The full-length protein consists of 459 amino acids and plays an essential role in synaptic transmission. The recombinant protein typically includes an N-terminal His-tag when expressed in E. coli expression systems. The protein contains multiple transmembrane domains characteristic of nicotinic acetylcholine receptor family members, contributing to the formation of functional ion channels that mediate fast synaptic transmission .

How does goldfish chrnb2 compare structurally with mammalian homologs?

While specific comparative data between goldfish and mammalian chrnb2 is limited in the current literature, research on nicotinic acetylcholine receptors shows conservation of key functional domains across vertebrate species. In mice, CHRNB2 plays a crucial role in retinal wave formation and proper projection of retinal ganglion cells to their targets in the dorsal lateral geniculate nuclei (dLGN) . The amino acid sequence of Carassius auratus chrnb2 (P19370) shows regions of high conservation in the ligand-binding and channel-forming domains when compared with mammalian counterparts, suggesting evolutionary preservation of core functional elements despite species divergence.

What expression systems are most effective for producing recombinant goldfish chrnb2?

The most commonly used and effective expression system for recombinant Carassius auratus chrnb2 is E. coli. The full-length protein (amino acids 1-459) can be successfully expressed with an N-terminal His-tag, allowing for efficient purification using metal affinity chromatography. The expressed protein typically achieves purity levels greater than 90% as determined by SDS-PAGE analysis . While E. coli is the predominant system, eukaryotic expression systems may offer advantages for studies requiring post-translational modifications, though these approaches are less documented in the available literature.

What are the optimal storage and handling conditions for recombinant goldfish chrnb2?

For optimal stability and activity, recombinant goldfish chrnb2 should be stored as follows:

  • Long-term storage: Keep lyophilized powder at -20°C/-80°C upon receipt

  • Working solutions: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For extended storage of reconstituted protein: Add glycerol to a final concentration of 50% and aliquot to avoid freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freeze-thaw cycles should be strictly avoided as they can significantly degrade protein quality and functional properties. Centrifuging the vial briefly before opening is recommended to ensure all content is collected at the bottom.

What reconstitution protocols yield optimal protein stability and activity?

For optimal reconstitution of lyophilized recombinant goldfish chrnb2:

  • Centrifuge the vial briefly before opening to collect all protein at the bottom

  • Reconstitute in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Mix gently by inversion or gentle pipetting to avoid protein denaturation

  • For long-term storage, add glycerol to a final concentration of 50%

  • Aliquot into smaller volumes based on experimental needs to minimize freeze-thaw cycles

  • Verify protein concentration after reconstitution using standard methods (Bradford, BCA, etc.)

Note that for functional studies, buffer conditions may need to be optimized based on specific experimental requirements.

How can the purity and integrity of recombinant goldfish chrnb2 be validated?

Multiple analytical methods can be employed to validate the purity and integrity of recombinant goldfish chrnb2:

  • SDS-PAGE analysis: Should show a single predominant band at approximately 50.27 kDa (including the N-terminal six-histidine tag and Trx fusion protein)

  • Western blotting: Can be performed using anti-His antibodies to verify the presence of the His-tag

  • Mass spectrometry: For accurate molecular weight determination and sequence verification

  • Circular dichroism: To assess secondary structure integrity

  • Size-exclusion chromatography: To evaluate protein homogeneity and detect potential aggregation

The purity of properly expressed and purified recombinant goldfish chrnb2 should exceed 90% as determined by SDS-PAGE analysis. Functional activity assays should be developed based on specific research objectives.

What cellular assays are most informative for studying goldfish chrnb2 function?

Based on studies of related nicotinic acetylcholine receptors, several cellular assays can provide valuable insights into goldfish chrnb2 function:

  • Proliferation assays: Similar to studies with MCSF-2, MTT assays can be used to assess the effect of chrnb2 on cell proliferation. Experiments should include appropriate controls and concentration gradients (e.g., 0.1, 0.25, 0.5, 0.75, and 1 μg/mL) with measurements at multiple time points (24h, 48h) .

  • Electrophysiological recordings: Patch-clamp techniques can assess ion channel function when chrnb2 is expressed in appropriate cellular systems.

  • Calcium imaging: Since nicotinic acetylcholine receptors mediate calcium influx, fluorescent calcium indicators can be used to monitor receptor activation and signal transduction.

  • Receptor binding assays: Using labeled ligands to determine binding affinity and kinetics.

  • Gene expression analysis: qPCR to measure changes in expression of downstream genes following receptor activation, similar to the approach used for analyzing transcription factors like MAFB, GATA2, and cMyb in response to stimulation .

How can transcriptional responses to chrnb2 modulation be effectively measured?

Based on methodologies used in related research, transcriptional responses to chrnb2 modulation can be measured as follows:

  • Real-time quantitative PCR (qPCR): This is the gold standard for measuring changes in gene expression. Key steps include:

    • Isolation of total RNA from treated cells/tissues

    • cDNA synthesis using reverse transcriptase

    • qPCR using gene-specific primers

    • Normalization to housekeeping genes (e.g., elongation factor 1 alpha (EF-1α))

    • Expression values should be normalized to control-treated cells

  • Experimental design considerations:

    • Include multiple time points (e.g., 6h and 12h post-treatment)

    • Use appropriate concentration of recombinant protein (e.g., 5 μg/mL)

    • Include proper controls (e.g., recombinant Trx tag alone)

    • Establish cultures from multiple biological replicates (n=6 recommended)

    • Apply statistical analysis using one-way ANOVA and Dunnett's post hoc test

  • Target genes of interest might include:

    • Proinflammatory cytokines (TNFα, IL-1β, IFNγ)

    • Transcription factors (MafB, GATA2, cMyb, cJun, Egr1, PU.1, Runx1)

    • Other neuronal markers relevant to acetylcholine receptor function

What is the significance of chrnb2 in goldfish neural development compared to other species?

While specific data on goldfish chrnb2 neural development roles is limited in the provided search results, comparative insights can be drawn from studies in other species:

In mouse models, CHRNB2 plays critical roles in:

  • Formation of normal retinal waves during development

  • Proper projection of retinal ganglion cell (RGC) axons to their dorsal lateral geniculate nuclei (dLGNs)

  • Expression of genes involved in cell adhesion and calcium signaling

  • Regulation of cadherin 1 (Cdh1) expression, which affects axon growth

In goldfish, we can hypothesize similar roles in neural development, particularly in:

  • Visual system development and refinement

  • Synaptic plasticity in the central nervous system

  • Axon guidance and target selection

Research approaches to explore these functions could include:

  • Developmental expression profiling across different stages

  • Morpholino or CRISPR-based knockdown/knockout studies

  • Calcium imaging during neural development

  • Electrophysiological recording of developing neural circuits

  • Axon tracing studies combined with chrnb2 manipulation

How can differential gene expression analysis be applied to understand chrnb2 signaling pathways?

Differential gene expression analysis provides powerful insights into chrnb2 signaling networks. A comprehensive approach should include:

  • Experimental Design:

    • Treatment groups: Cells/tissues with activated, inhibited, or normal chrnb2 function

    • Control groups: Appropriate vehicle or inactive protein controls

    • Multiple time points to capture immediate-early, intermediate, and late response genes

    • Multiple biological replicates (minimum n=3, preferred n=6)

  • Transcriptomic Approaches:

    • RNA-Seq provides unbiased, genome-wide expression profiling

    • Microarray analysis for targeted gene expression studies

    • NanoString for validating selected gene panels

  • Bioinformatic Analysis Pipeline:

    • Quality control and normalization of transcriptomic data

    • Identification of differentially expressed genes using tools like DESeq2 or edgeR

    • Pathway enrichment analysis using KEGG, GO, or Reactome databases

    • Network analysis to identify hub genes and regulatory motifs

  • Validation Strategies:

    • qPCR for selected target genes

    • Western blotting for protein-level validation

    • Functional assays for key identified pathways

This approach could identify genes similar to the transcription factors (MafB, GATA2, cMyb) and cytokines (TNFα, IL-1β) that were modulated in response to treatment in related studies .

What are the most effective approaches for studying chrnb2 involvement in neuroprotection?

To investigate goldfish chrnb2's potential neuroprotective functions, researchers should consider:

  • In vitro Models of Neuronal Injury:

    • Excitotoxicity models using glutamate or NMDA

    • Oxidative stress models using H₂O₂ or paraquat

    • Oxygen-glucose deprivation models mimicking ischemia

    • Measure outcomes like viability, apoptosis markers, calcium dynamics, and mitochondrial function

  • Modulation Approaches:

    • Recombinant chrnb2 administration

    • Agonists/antagonists of nicotinic acetylcholine receptors

    • Gene overexpression or knockdown techniques

    • Time-course and dose-response studies for intervention optimization

  • Mechanistic Studies:

    • Calcium imaging to monitor neuronal activity and excitotoxicity

    • Mitochondrial function assays (membrane potential, ROS production)

    • Analysis of key neuroprotective signaling pathways (PI3K/Akt, MAPK, etc.)

    • Gene expression changes in neuroprotective factors

  • Translation to In vivo Models:

    • Retinal degeneration models (relevant given known roles in visual system)

    • Brain injury or ischemia models

    • Behavioral assessments of neurological function

Particular attention should be paid to pathways identified in related research, such as effects on inflammatory cytokines (TNFα, IL-1β) and transcription factors (MafB, GATA2, cMyb) that might mediate neuroprotective functions .

How do mutations in chrnb2 affect neural circuit development and function?

Based on findings from mouse models and extrapolating to goldfish systems, research on chrnb2 mutations should address:

  • Circuit Formation Analysis:

    • Retinal wave recording to assess spontaneous activity patterns

    • Axon tracing studies to examine projection patterns to target regions

    • Synaptogenesis assessment using immunohistochemistry and electron microscopy

    • Molecular profiling of affected neural populations

  • Electrophysiological Characterization:

    • Patch-clamp recordings to assess channel kinetics of mutant receptors

    • Field potential recordings to evaluate circuit-level activity

    • Multi-electrode array recordings to capture network dynamics

    • Calcium imaging to visualize activity patterns across neural populations

  • Molecular Consequences:

    • Analysis of adhesion molecule expression (e.g., cadherin 1)

    • Assessment of calcium signaling pathway components

    • Expression profiling of key developmental regulators

    • Proteomic analysis of synaptic composition

  • Developmental Timeline Studies:

    • Temporal analysis of circuit formation across developmental stages

    • Critical period identification for chrnb2-dependent processes

    • Intervention studies to rescue developmental defects

In mouse models, Chrnb2 mutations led to reduced expression of genes involved in cell adhesion and calcium signaling, particularly cadherin 1 (Cdh1), which regulates axon growth. Similar molecular pathways might be affected in goldfish with chrnb2 mutations, potentially disrupting the precise wiring of neural circuits, particularly in the visual system .

What strategies can overcome solubility issues with recombinant goldfish chrnb2?

Recombinant transmembrane proteins like goldfish chrnb2 often present solubility challenges. Effective strategies include:

  • Optimization of Expression Constructs:

    • Express soluble domains separately if full-length protein proves difficult

    • Use solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Modify N- or C-terminal regions to improve solubility while preserving function

  • Expression Conditions Optimization:

    • Reduce expression temperature (16-18°C)

    • Use specialized E. coli strains designed for membrane proteins

    • Test induction with varying IPTG concentrations (0.1-1.0 mM)

    • Extend expression time with lower inducer concentration

  • Extraction and Solubilization:

    • Screen multiple detergents (DDM, LDAO, Triton X-100, CHAPS)

    • Test detergent mixtures and concentrations

    • Include stabilizing additives (glycerol, specific lipids, cholesterol)

    • Consider native nanodiscs or amphipols for maintaining native conformation

  • Refolding Approaches:

    • Gradual dialysis to remove denaturants

    • Pulsed refolding techniques

    • Chaperone co-expression systems

    • On-column refolding during purification

For goldfish chrnb2 specifically, Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successfully used for storage of the purified protein .

How can specificity of antibodies against goldfish chrnb2 be validated for immunological studies?

Validating antibody specificity for goldfish chrnb2 requires multiple complementary approaches:

  • Positive Controls:

    • Western blot analysis using purified recombinant goldfish chrnb2

    • Cells/tissues with confirmed high chrnb2 expression

    • Overexpression systems (transfected cells)

  • Negative Controls:

    • Tissues/cells known to lack chrnb2 expression

    • Competitive binding with excess recombinant protein

    • Pre-absorption controls

    • siRNA or CRISPR knockout validation

  • Cross-Reactivity Assessment:

    • Test against closely related proteins (other nAChR subunits)

    • Validation across multiple techniques (Western blot, IHC, IF, IP)

    • Peptide array analysis to confirm epitope specificity

  • Reproducibility Testing:

    • Multiple antibody lots

    • Different sample preparation methods

    • Various fixation protocols for immunohistochemistry

  • Alternative Detection Methods:

    • Use anti-His antibodies for recombinant His-tagged chrnb2

    • Epitope-tagged constructs as alternative detection strategy

    • Mass spectrometry validation of immunoprecipitated proteins

Since recombinant goldfish chrnb2 is typically produced with a His-tag, anti-His antibodies can provide a reliable detection method for the recombinant protein, as demonstrated in Western blot analyses .

What are the key considerations for designing functional assays that differentiate between different nicotinic receptor subtypes?

Designing assays that specifically measure goldfish chrnb2 activity requires careful consideration of:

  • Pharmacological Approach:

    • Utilize subtype-selective agonists and antagonists

    • Establish dose-response relationships for different ligands

    • Compare EC50/IC50 values with known receptor subtype profiles

    • Consider allosteric modulators for additional selectivity

  • Electrophysiological Characterization:

    • Channel kinetics analysis (open time, conductance)

    • Desensitization properties

    • Ion selectivity measurements

    • Response to specific agonists/antagonists

  • Expression System Selection:

    • Heterologous systems lacking endogenous nicotinic receptors

    • Co-expression with different alpha subunits to form specific receptor subtypes

    • Careful control of expression levels to avoid non-physiological interactions

  • Readout Technology:

    • Membrane potential dyes for high-throughput screening

    • Calcium indicators for functional calcium influx measurement

    • FLIPR-based assays for kinetic analysis

    • Bioluminescence resonance energy transfer (BRET) for conformational changes

  • Binding Studies:

    • Radioligand binding with subtype-selective compounds

    • Competition binding experiments

    • Association/dissociation kinetics

    • Thermodynamic binding parameters

  • Controls and Validation:

    • Known subtype-selective compounds as reference standards

    • Mutant receptors with altered pharmacology

    • Knockdown/knockout validation in native systems

How might single-cell transcriptomics advance understanding of chrnb2 function in goldfish neural circuits?

Single-cell transcriptomics offers powerful new approaches to understanding chrnb2 function:

  • Cell Type-Specific Expression Patterns:

    • Identification of all cell populations expressing chrnb2 in goldfish nervous system

    • Quantification of expression levels across different neuronal and glial subtypes

    • Co-expression analysis with other nAChR subunits to determine receptor composition

    • Developmental trajectories of chrnb2 expression in different cell lineages

  • Response to Perturbations:

    • Single-cell profiling after pharmacological modulation of nAChRs

    • Changes in transcriptional programs following chrnb2 activation or inhibition

    • Cell type-specific responses to chrnb2 manipulation

    • Identification of downstream signaling cascades in responsive cells

  • Circuit Mapping Applications:

    • Correlation of chrnb2 expression with specific circuit components

    • Integration with connectomic data to link receptor expression to circuit function

    • Spatial transcriptomics to map chrnb2-expressing cells within intact tissues

    • Characterization of transcriptional changes in target cells of chrnb2-expressing neurons

  • Comparative Approaches:

    • Evolutionary conservation of chrnb2-associated transcriptional programs

    • Species-specific adaptations in goldfish compared to other vertebrates

    • Functional diversification of nicotinic receptor-expressing cells

Similar to studies of transcription factors in response to stimulation, single-cell approaches could reveal how chrnb2 activation influences expression of genes like MafB, GATA2, and cMyb in specific cell populations .

What is the potential for targeted chrnb2 modulation in treating neurodegenerative conditions?

While specific data on goldfish chrnb2 in neurodegeneration is limited, research insights suggest potential therapeutic applications:

  • Neuroprotective Mechanisms:

    • Modulation of calcium signaling pathways

    • Regulation of inflammatory responses (similar to effects on TNFα and IL-1β)

    • Influence on transcription factors that control neuronal survival

    • Potential effects on cell adhesion molecules relevant to synaptic maintenance

  • Disease Models Relevance:

    • Visual system degeneration (based on roles in retinal development)

    • Cholinergic system dysfunction in neurodegenerative diseases

    • Synaptic loss models

    • Excitotoxicity-based neuronal injury

  • Therapeutic Strategies:

    • Allosteric modulators of chrnb2-containing receptors

    • Gene therapy approaches to normalize expression

    • Cell-specific targeting of interventions

    • Combination therapies targeting multiple aspects of cholinergic signaling

  • Translational Considerations:

    • Comparative efficacy across species models

    • Delivery methods for targeting specific neural circuits

    • Biomarkers for patient stratification

    • Safety and specificity of cholinergic modulation

Research in mouse models has shown that chrnb2 mutations affect genes involved in cell adhesion and neurodegeneration response, suggesting potential therapeutic targets for intervention .

How can computational modeling enhance our understanding of goldfish chrnb2 structure-function relationships?

Computational approaches offer valuable insights for studying goldfish chrnb2:

  • Structural Modeling:

    • Homology modeling based on crystallized nicotinic receptor structures

    • Molecular dynamics simulations to study conformational changes

    • Ligand docking to predict binding modes of agonists and antagonists

    • Analysis of species-specific structural features

  • Systems Biology Approaches:

    • Network modeling of chrnb2-associated signaling pathways

    • Prediction of transcriptional regulatory networks

    • Dynamical systems analysis of receptor activation and desensitization

    • Multi-scale modeling linking molecular events to cellular responses

  • Machine Learning Applications:

    • Prediction of functional consequences of sequence variations

    • Classification of compounds based on receptor subtype selectivity

    • Analysis of large-scale electrophysiological datasets

    • Integration of multi-omics data to identify key regulatory nodes

  • Evolutionary Analysis:

    • Sequence conservation mapping to functional domains

    • Identification of positively selected residues

    • Reconstruction of ancestral sequences

    • Coevolution analysis with interacting proteins

  • Practical Implementation:

    • Integration of computational predictions with experimental validation

    • Iterative refinement of models based on experimental data

    • Design of targeted mutations to test structure-function hypotheses

    • Virtual screening for novel modulators of chrnb2 function

The full amino acid sequence of goldfish chrnb2 (459 amino acids) provides an excellent foundation for computational approaches, with specific attention to the functional domains that mediate ligand binding and channel formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.