Recombinant Carassius auratus Red-sensitive opsin

Shipped with Ice Packs
In Stock

Description

Spectral Sensitivity and Functional Role

Goldfish red-sensitive opsin exhibits a peak absorbance wavelength (λ<sub>max</sub>) of 559 ± 4 nm, corresponding to red light . This sensitivity is critical for detecting long-wavelength light in aquatic environments.

PropertyValueMechanismSource
λ<sub>max</sub>559 nmTuned by amino acid residues interacting with the retinal chromophore
Chromophore11-cis-retinalBinds covalently to opsin, enabling light-driven conformational changes

Amino acid substitutions at key tuning sites (e.g., S180A, H197Y) can shift λ<sub>max</sub> up to 28 nm toward blue or red, modulating spectral sensitivity .

Research Applications and Experimental Insights

This recombinant protein is instrumental in studying:

  • Visual Pigment Evolution: Comparisons with other vertebrates reveal conserved and divergent tuning mechanisms .

  • Color Vision Models: Used to regenerate "true" red pigments for testing color vision hypotheses in mammals and fish .

  • Structural Biology: Full-length constructs enable crystallization and cryo-EM studies of opsin-retinal complexes .

Key Findings:

  • Gene Duplication and Tuning: In characiform fish, LWS opsins (e.g., goldfish red-sensitive opsin) often undergo duplication and substitutions to optimize sensitivity to aquatic light environments .

  • Functional Reconstitution: Recombinant opsins reconstituted with 11-cis-retinal in vitro replicate native spectral properties, validating their use in phototransduction assays .

Comparative Analysis of Red-Sensitive Opsins

Speciesλ<sub>max</sub> (nm)Opsin ClassKey SubstitutionsSource
Carassius auratus559LWSS180A, H197Y, Y277F
Equus caballus545LWST285A, A308S
Sciurus carolinensis532LWSS180A, H197Y

Goldfish red-sensitive opsin shares structural homology with mammalian LWS opsins but exhibits distinct tuning residues, highlighting convergent evolution in red-light sensitivity .

Limitations and Future Directions

While recombinant red-sensitive opsin provides critical insights, challenges remain:

  • Partial Constructs: Truncated versions may lack functional domains, limiting phototransduction studies .

  • Chromophore Proportions: Native A1/A2 ratios (11-cis-retinal vs. 11-cis-3,4-dehydroretinal) influence spectral shifts, requiring careful reconstitution .

Future research may explore its role in non-visual photoreception, such as circadian regulation or reproductive signaling, analogous to green-sensitive VAL-opsin in goldfish .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your desired format during order placement.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for your application.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development according to your specification.
Synonyms
Red-sensitive opsin; Red cone photoreceptor pigment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Carassius auratus (Goldfish)
Target Protein Sequence
MAEQWGDAIFAARRRGDETTRESMFVYTNSNNTRDPFEGPNYHIAPRWVYNLATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAVADLAETLLASTISVTNQFFGYFILGH PMCIFEGFTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWSAIW CAPPIFGWSRFWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCIIPLAIIILCYIAVW LAIRTVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFCACFAAANPGYAFHPLA AAMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA
Uniprot No.

Target Background

Function
Visual pigments, the light-absorbing molecules mediating vision, are composed of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.

Q&A

What is Recombinant Carassius auratus Red-sensitive Opsin?

Recombinant Carassius auratus Red-sensitive opsin is a laboratory-produced version of the photosensitive protein naturally found in goldfish retinal photoreceptors. This protein belongs to the opsin family of G-protein coupled receptors, specifically the long-wavelength sensitive (LWS) class. When bound to a chromophore (typically 11-cis-retinal), it forms the molecular basis for red color vision in goldfish.

The protein is characterized by its UniProt accession number P32313 and consists of 357 amino acids in its full-length form . It is also referred to as "Red cone photoreceptor pigment" in the scientific literature . Recombinant versions of this protein are typically produced in expression systems such as E. coli for research applications .

What are the Optimal Storage and Handling Conditions for Recombinant Opsin Proteins?

For optimal preservation of recombinant opsin protein activity, researchers should follow these methodological guidelines:

  • Store the protein at -20°C for regular use, or at -80°C for extended storage periods .

  • Working aliquots can be maintained at 4°C for up to one week .

  • Avoid repeated freezing and thawing cycles as these can significantly degrade protein quality and functionality .

  • When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Add 5-50% glycerol (final concentration) before aliquoting for long-term storage to enhance stability .

  • When working with reconstituted opsin and chromophore, perform procedures in dark conditions to prevent premature photobleaching of the visual pigment .

  • For reconstituted visual pigments, store in appropriate buffers (typically Tris-based) that maintain protein stability .

These handling protocols are essential for maintaining the structural integrity and functional properties of the recombinant opsin proteins in laboratory settings.

What Expression Systems are Most Effective for Producing Functional Recombinant Opsins?

Multiple expression systems have been developed for the production of functional recombinant opsins, each with specific advantages:

Bacterial Expression Systems

E. coli expression systems can be used to produce recombinant Carassius auratus Red-sensitive opsin as documented in multiple sources . These systems typically offer:

  • High protein yield

  • Relatively simple laboratory protocols

  • Cost-effectiveness for large-scale production

Mammalian Cell Culture Systems

HEK293T cell culture systems have been specifically optimized for opsin expression:

  • Engineered expression cassettes with strong cytomegalovirus (CMV) promoters enhance membrane protein expression levels .

  • These systems can efficiently produce monomeric units of opsin proteins that are more likely to maintain native conformation .

  • Large-scale HEK293T cell cultures followed by purification have successfully produced functional recombinant opsins for spectroscopic characterization .

Tag Selection and Purification Strategy

The addition of affinity tags facilitates purification:

  • N-terminal 10xHis-tags are commonly used for the full-length version of goldfish Red-sensitive opsin .

  • The tag type can be determined during the production process based on specific experimental requirements .

  • Purification protocols must be optimized to maintain the native structure of the transmembrane protein.

This methodological approach enables researchers to produce pure opsin proteins for spectroscopic analysis, mutagenesis studies, and biochemical investigations without the confounding factors present in native retinal tissues.

How Can Researchers Measure the Spectral Properties of Recombinant Opsin-based Visual Pigments?

Multiple complementary approaches can be employed to characterize the spectral properties of recombinant opsins:

In Vitro Reconstitution Protocol

  • Express and purify the recombinant opsin protein using appropriate expression systems.

  • Reconstitute the visual pigment by combining purified opsin with 11-cis-retinal in dark conditions .

  • Allow sufficient time for chromophore binding and protein stabilization.

  • Compare in vitro spectral measurements with in vivo data from ERG or behavioral tests to validate physiological relevance .

  • Use site-directed mutagenesis to confirm the role of specific amino acids in spectral tuning, comparing wild-type and mutant opsins .

  • Include appropriate controls such as reconstitution without chromophore or with denatured protein.

These methodological approaches provide a comprehensive characterization of opsin spectral properties, essential for understanding their role in color vision.

How Does Androgen Regulation Affect Red-sensitive Opsin Expression and Function?

Research on sticklebacks (Gasterosteus aculeatus) has revealed sophisticated hormonal regulation of red-sensitive opsin expression, which may have parallels in goldfish:

Molecular Mechanism

Androgens directly regulate the expression of the lws (long-wavelength sensitive) opsin gene in male sticklebacks . This regulation involves:

  • Upregulation of lws mRNA levels in sexually mature males maintained under long-day photoperiods (L16:D8) .

  • Reduced lws expression following castration, which can be restored by treatment with the androgen 11-ketoandrostenedione (11KA) .

  • Selective modulation of lws expression without affecting other opsin genes like rh2 (green-sensitive) .

Physiological Effects

This hormonal regulation has direct consequences for visual function:

  • Electroretinogram (ERG) data confirms that sexual maturation results in higher relative red spectral sensitivity .

  • Males under long-day conditions (L16:D8) exhibit greater sensitivity to red light than males under short-day conditions (L8:D16) .

  • Red light sensitivity under long-day conditions is diminished by castration but increased by 11KA treatment .

Evolutionary and Behavioral Significance

The androgen-dependent enhancement of red sensitivity likely evolved in relation to breeding behaviors:

  • Increased red sensitivity correlates with the breeding season when males develop red nuptial coloration .

  • Both sexes display increased red sensitivity during the breeding period, though through potentially different hormonal mechanisms .

  • This sensory adaptation enhances the ability to detect red breeding signals, demonstrating the integration of sensory and reproductive systems.

This research establishes that "in sexually mature male sticklebacks, androgen is a key factor in enhancing sensitivity to red light via regulation of opsin gene expression" , providing a model system for understanding hormonal influences on visual perception.

How Can Recombinant Opsins Be Used to Study Evolutionary Mechanisms of Spectral Tuning?

Recombinant opsin technology enables detailed investigation of evolutionary mechanisms underlying spectral tuning through several methodological approaches:

Comparative Spectroscopic Analysis

Expression and characterization of opsins from different species reveals natural variations in spectral sensitivity:

  • Lycaenid butterfly LW opsins absorb at significantly longer wavelengths (λmax = 569-578 nm) compared to ancestral green insect LW rhodopsins (λmax = 520-530 nm) .

  • This comparative approach can identify convergent evolution of red sensitivity through different molecular mechanisms across distantly related taxa.

Site-Directed Mutagenesis Studies

Recombinant expression systems allow systematic mutagenesis to test the effects of specific amino acid substitutions:

  • In Papilio butterflies, green sensitivity is achieved via tuning residues in helix 3 of LW opsins .

  • Different spectral tuning mechanisms have evolved in lycaenids, which possess a highly conserved helix 3 lacking those substitutions .

  • Similar approaches can be applied to fish opsins to identify key residues responsible for spectral tuning.

Isolation of Pure Opsin Effects

Recombinant systems separate intrinsic opsin spectral properties from other mechanisms affecting photoreceptor sensitivity in vivo:

  • LW opsin proteins alone can dramatically increase photoreceptor response at longer wavelengths, independent of filtering pigments or other cellular mechanisms .

  • This approach helps distinguish genetic adaptations from physiological adaptations.

Chromophore Exchange Experiments

Recombinant opsins can be reconstituted with different chromophores:

  • Shifting between vitamin A1 and A2 chromophores can tune spectral sensitivity, as mentioned in studies of eel and rainbow trout .

  • Evaluating the same opsin with different chromophores helps distinguish protein-based versus chromophore-based tuning mechanisms.

These approaches have revealed that distinct spectral tuning mechanisms have evolved independently in different lineages, highlighting the multiple evolutionary pathways to similar visual adaptations.

What Factors Influence Opsin Expression and Spectral Sensitivity in Retinal Tissues?

Multiple factors regulate opsin expression and resulting spectral sensitivity in fish retinal tissues:

Hormonal Regulation

  • Androgens significantly upregulate lws opsin expression in sexually mature male sticklebacks .

  • 11-ketoandrostenedione (11KA) treatment increases red sensitivity in castrated males .

  • Thyroid hormones (T4 and T3) may interact with the reproductive endocrine system to influence both opsin expression and chromophore type .

Environmental Factors

  • Photoperiod: Fish maintained under long-day conditions (L16:D8) show higher lws expression and red sensitivity than those under short-day conditions (L8:D16) .

  • Ambient light conditions: Aquatic animals adapt their visual systems to match the light properties of their environment .

  • Seasonal changes: Sticklebacks exhibit higher sensitivity to red light during summer breeding periods compared to winter .

Developmental and Physiological State

  • Sexual maturation: Red-sensitive opsin gene (lws) mRNA levels are higher in sexually mature than in immature fish of both sexes .

  • Life stage: Opsin expression patterns may change during development, as seen in studies of juvenile rainbow trout .

Retinal Topography

Different regions of the retina can express different opsin combinations:

  • In the Japanese anchovy, ventro-temporal retinal cones express pure RH2 class pigments (λmax = 492 nm), while other retinal regions contain mixtures of RH2 and LWS pigments .

  • This regional specialization allows for optimal visual processing in different parts of the visual field.

Understanding these regulatory mechanisms provides insight into how visual systems adapt to changing environmental conditions and physiological states, with implications for ecological and evolutionary studies.

What Techniques Can Be Used to Study Co-expression of Multiple Opsins in Photoreceptor Cells?

Investigating the co-expression of multiple opsins in the same photoreceptor cells requires specialized techniques:

Immunohistochemical Approaches

  • Development of specific antibodies against different opsin types enables visualization of their expression patterns in retinal tissues .

  • Serial section immunohistochemistry can overcome the limitation when antibodies are raised in the same animal species. Thin sections (6 μm thick) of retinal tissue can be used to detect co-expression patterns in neighboring sections .

  • Large dimension photoreceptors can be tracked across multiple sections to establish co-localization of different opsins .

Molecular Quantification Methods

  • Quantitative PCR (qPCR) analysis can determine the relative abundance of different opsin mRNAs in retinal tissues .

  • Transcriptome profiling can identify the complete complement of opsin genes expressed in the retina .

  • Single-cell RNA sequencing could potentially identify co-expression patterns at the individual cell level.

Functional Characterization

  • Microspectrophotometry of single photoreceptors can reveal the presence of multiple visual pigments through complex absorption spectra .

  • Electrophysiological recordings can detect responses to multiple wavelengths that would not be expected from a single opsin type.

  • By expressing individual opsins in vitro and determining their spectral properties, researchers can interpret the complex spectral responses of photoreceptors that co-express multiple opsins.

These methodological approaches help understand how the co-expression of multiple opsins contributes to the complex spectral sensitivities of photoreceptors in different species and ecological contexts.

  • Full-length proteins are essential for functional studies requiring intact structure, including all transmembrane domains and binding sites.

  • Partial recombinant proteins may be more suitable for raising antibodies or for structural studies focusing on specific domains.

  • Expression and purification of full-length transmembrane proteins typically present greater technical challenges due to their hydrophobic regions.

  • For spectroscopic studies of reconstituted visual pigments, the full-length version is necessary to ensure proper chromophore binding and spectral characteristics.

These differences highlight the importance of selecting the appropriate recombinant protein version based on the specific requirements of the research application.

How Does the Spectral Sensitivity of Goldfish Red-sensitive Opsin Compare to Red-sensitive Opsins in Other Species?

Comparative analysis reveals both similarities and differences in red-sensitive opsins across species:

Red-sensitive opsins have evolved independently in different lineages through distinct molecular mechanisms:

  • Different spectral tuning sites have been identified in vertebrate versus invertebrate lineages .

  • In Papilio butterflies, green sensitivity is achieved via tuning residues in helix 3, while lycaenid LW opsins use different tuning mechanisms .

  • These differences highlight the convergent evolution of red vision through different molecular pathways.

Functional Adaptations

Despite molecular differences, red-sensitive opsins serve similar ecological functions:

  • Enhanced sensitivity to red wavelengths is often associated with breeding behaviors, as in sticklebacks .

  • Red sensitivity may also be adaptive for detecting food sources or navigating specific light environments.

  • The regulatory mechanisms (such as hormonal control) may show convergence across species even when the molecular tuning mechanisms differ.

This comparative approach underscores the diversity of spectral tuning mechanisms that have evolved to enable red sensitivity in different species, adapted to their specific ecological and behavioral requirements.

What Future Research Directions Could Advance Our Understanding of Red-sensitive Opsins?

Several promising research directions could enhance our understanding of goldfish Red-sensitive opsin and related visual pigments:

Advanced Structural Studies

  • Cryo-electron microscopy of purified recombinant opsin could provide high-resolution structural data.

  • Molecular dynamics simulations based on these structures could identify conformational changes during photoactivation.

  • Structure-guided mutagenesis could further elucidate the specific amino acids responsible for red sensitivity in goldfish opsins.

Chromophore Interactions

  • Studies examining how goldfish Red-sensitive opsin interacts with different chromophores (A1 vs. A2) could reveal additional tuning mechanisms.

  • Investigation of whether seasonal or environmental changes trigger chromophore shifts in goldfish, as suggested for other species .

Optogenetic Applications

  • Modified versions of red-sensitive opsins could be developed as optogenetic tools for neuroscience research.

  • The red-shifted absorption spectrum would allow deeper tissue penetration of activating light.

Evolutionary Genomics

  • Comparative genomic analysis across Cypriniformes could identify selection pressures acting on red-sensitive opsins.

  • Investigation of opsin gene duplications and subfunctionalization in the goldfish genome, which has undergone recent whole-genome duplication.

Environmental Adaptation Studies

  • Examining how environmental pollutants or changing light conditions affect opsin expression and function.

  • Investigating potential impacts of climate change on visual ecology through altered opsin expression patterns.

These research directions would contribute significantly to our understanding of visual ecology, molecular evolution, and the adaptability of sensory systems across diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.