Recombinant Carassius auratus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Molecular Structure of Recombinant Carassius auratus Rhodopsin

Sequence Composition:

  • The rho gene encodes a 348-amino-acid protein with a molecular weight of ~39 kDa .

  • Key structural features include seven transmembrane domains (TM1–TM7), intracellular/extracellular loops, and an N-terminal domain critical for chromophore binding .

Sequence Highlights:

RegionAmino Acid Sequence (Selected Segments)
N-terminalMNGTEGDMFYVPMSNATGVVRSPYDYPPYYLVAPWA...
Transmembrane 1LVAPWACLAAYMFFLIITGFPVNFTLYV...
Transmembrane 7YNPCMYCMNHKQFRHCMITTLCCGKN...
C-terminalEEEGASTTASKTEASSSVSSSSVSPA

Source: GPCRdb

Functional and Biophysical Properties

Chromophore Interaction:

  • Binds 11-cis-retinaldehyde to form functional rhodopsin, enabling light absorption and conformational activation .

  • Mutations in analogous human RHO disrupt chromophore binding or protein folding, leading to retinal dystrophies .

Thermal Stability:

  • Comparative studies suggest recombinant C. auratus rhodopsin shares stability traits with mammalian homologs. For example, human rhodopsin mutants like G51A exhibit reduced thermal stability compared to ancestral forms .

Research Applications and Therapeutic Insights

Gene Therapy Models:

  • Studies on RHO mutations in humans (e.g., P23H, T17M) inform strategies for rescuing misfolded rhodopsin via pharmacological chaperones (e.g., YC-001) or CRISPR/Cas9 editing .

  • Dual vector systems combining gene suppression and replacement have preserved photoreceptor function in murine models of autosomal dominant retinitis pigmentosa (adRP) .

Experimental Tools:

  • Recombinant C. auratus rhodopsin serves as a model for studying GPCR signaling mechanisms and retinal degeneration pathways .

Comparative Analysis with Other Species

FeatureC. auratus RhodopsinHuman Rhodopsin
Amino Acid Length348348
Chromophore Binding11-cis-retinaldehyde11-cis-retinaldehyde
Mutation HotspotsN/A (limited data)P23H, G90D, T17M
Thermal StabilityHigh (inferred from homologs)Variable (mutation-dependent)

Sources:

Outstanding Research Questions

  • Expression Systems: Optimal platforms (e.g., AAV, bacterial) for large-scale production remain underexplored for C. auratus rhodopsin .

  • Mutation Screening: Only ~55% of pathogenic RHO single-nucleotide variants in humans are editable via CRISPR base editors due to PAM site limitations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Carassius auratus (Goldfish)
Target Names
rho
Target Protein Sequence
MNGTEGDMFYVPMSNATGIVRSPYDYPQYYLVAPWAYACLAAYMFFLIITGFPVNFLTLY VTIEHKKLRTPLNYILLNLAISDLFMVFGGFTTTMYTSLHGYFVFGRVGCNPEGFFATLG GEMGLWSLVVLAFERWMVVCKPVSNFRFGENHAIMGVVFTWFMACTCAVPPLVGWSRYIP EGMQCSCGVDYYTRPQAYNNESFVIYMFIVHFIIPLIVIFFCYGRLVCTVKEAAAQHEES ETTQRAEREVTRMVVIMVIGFLICWIPYASVAWYIFTHQGSEFGPVFMTLPAFFAKTAAV YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function

Photoreceptor essential for low-light vision. While most marine fish utilize retinal as a chromophore, most freshwater fish use 3-dehydroretinal, or a mixture of both. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating signaling.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the molecular structure of Carassius auratus Rhodopsin?

Carassius auratus Rhodopsin is a photoreceptor protein belonging to the G-protein coupled receptor 1 family, specifically the Opsin subfamily . It consists of 354 amino acids with an approximate molecular mass of 40 kDa . As a prototypic GPCR, it contains seven membrane-spanning domains responsible for photon capture in rod photoreceptor cells . The protein's tertiary structure facilitates light-induced conformational changes essential for visual signaling.

What is the signaling mechanism of Carassius auratus Rhodopsin?

Carassius auratus Rhodopsin functions through a light-induced isomerization mechanism. When 11-cis retinal (the chromophore) absorbs a photon, it isomerizes to all-trans retinal, triggering a conformational change in the protein . This activation enables the rhodopsin to interact with G-proteins, initiating the visual signal transduction cascade. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process . This precise molecular machinery enables rods to detect photons with extremely high signal-to-noise ratio in low-light conditions .

How does chromophore usage differ in Carassius auratus compared to other fish species?

While most saltwater fish species utilize retinal (vitamin A1-derived) as their chromophore, freshwater fish including Carassius auratus predominantly use 3-dehydroretinal (vitamin A2-derived) or a mixture of both retinal and 3-dehydroretinal . This chromophore difference represents a significant adaptive feature that affects spectral sensitivity. Research methodologies to investigate this phenomenon typically involve HPLC analysis of retinal extracts and spectroscopic characterization of reconstituted pigments to determine precise chromophore ratios and resulting spectral tuning.

What is the significance of thermal isomerization rates in rhodopsin function?

Rhodopsin exhibits remarkably low rates of thermal isomerization of the retinal chromophore compared to cone visual pigments . This property is crucial for achieving the high signal-to-noise ratio required for scotopic (low-light) vision. Researchers investigating thermal isomerization typically employ dark noise measurements in electrophysiological recordings or direct biochemical assays that monitor spontaneous activation events over time. This methodology allows quantification of the extraordinarily rare thermal isomerization events that contribute to the background noise limiting the visual threshold .

Visual Pigment TypeThermal Isomerization RateFunction
Rhodopsin (rod pigment)Very lowEnables scotopic vision with high sensitivity
Cone Pigments (typical)HigherOptimized for photopic (bright light) vision
Anura Blue-sensitive Cone PigmentLow (similar to rhodopsin)Adapted for scotopic vision in green rods
Urodela Blue-sensitive Cone PigmentHigh (similar to typical cone pigments)Functions as normal cone pigment

What expression systems are most effective for producing recombinant Carassius auratus Rhodopsin?

For successful expression of functional Carassius auratus Rhodopsin, researchers should consider several expression systems, each with distinct advantages:

  • Mammalian cell lines (HEK293, COS-7): Provide appropriate post-translational modifications and membrane environments

  • Insect cell systems (Sf9, High Five): Offer higher yields while maintaining proper protein folding

  • Yeast expression systems (Pichia pastoris): Balance between yield and eukaryotic processing

The methodological approach should include codon optimization for the selected expression system, inclusion of appropriate affinity tags for purification, and careful temperature control during expression (typically 28-30°C) to maximize functional protein yield. Expression conditions must be optimized to ensure proper incorporation of the chromophore, either through co-expression with enzymes for chromophore synthesis or post-expression reconstitution .

What purification strategies yield functionally intact recombinant rhodopsin?

Purification of functional Carassius auratus Rhodopsin requires specialized techniques that preserve the delicate protein-chromophore interaction:

  • Preparation conditions: All procedures should be performed under dim red light (>650 nm) to prevent unwanted chromophore isomerization

  • Solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration are optimal

  • Chromatography sequence:

    • Initial capture via affinity chromatography (e.g., IMAC for His-tagged constructs)

    • Size exclusion chromatography to isolate monomeric/dimeric species

    • Optional ion exchange step for highest purity

Researchers should verify purification success through UV-visible spectroscopy, confirming the characteristic absorption peak at ~500 nm, and assess functionality through G-protein activation assays .

How has Carassius auratus Rhodopsin evolved compared to other vertebrate opsins?

Rhodopsin type 2 (RH2) opsins, which include Carassius auratus Rhodopsin, show the largest number of gene duplication events among the five groups of vertebrate visual pigments . The evolutionary rates of RH2 opsins in early vertebrate ancestors were approximately 0.25 × 10^-9 substitutions/site/year, which increased to approximately 1-3 × 10^-9 substitutions/site/year in teleost lineages . This accelerated evolution suggests adaptation to diverse spectral environments.

When investigating evolutionary relationships, researchers employ phylogenetic analyses based on multiple sequence alignments and ancestral sequence reconstruction methodologies. These approaches reveal key amino acid substitutions that emerged during adaptation to different light environments and can identify critical residues for spectral tuning .

What unique adaptations exist in amphibian rhodopsin that might inform research on fish visual pigments?

Amphibians exhibit a fascinating adaptation in their visual systems that provides insights for fish rhodopsin research. Specifically, anurans (frogs and toads) possess two types of rod photoreceptors: red rods that express rhodopsin and green rods that uniquely express blue-sensitive cone pigments .

The blue-sensitive cone pigments in anuran green rods have evolved low thermal isomerization rates similar to rhodopsin through a single critical amino acid mutation at position 47 (Thr47) . This adaptation allowed these cone pigments to function effectively in scotopic vision. When designing comparative studies between fish and amphibian visual systems, researchers should employ site-directed mutagenesis to assess whether similar adaptations have occurred independently in fish lineages adapting to different light environments.

How can recombinant Carassius auratus Rhodopsin be used to study visual adaptation mechanisms?

Recombinant Carassius auratus Rhodopsin serves as an excellent model for investigating adaptation to different light environments. Methodological approaches include:

  • Spectroscopic characterization: Determine absorption maxima and investigate spectral tuning using UV-visible spectroscopy of purified proteins

  • Electrophysiological assays: Assess photoresponse kinetics in reconstituted systems or transfected cells

  • Comparative studies: Evaluate functional differences between rhodopsins from fish species inhabiting different depths or water clarities

Researchers can employ site-directed mutagenesis to create targeted amino acid substitutions, followed by functional characterization to identify residues responsible for spectral tuning and kinetic properties .

What techniques are most effective for measuring rhodopsin photobleaching and regeneration?

To quantify photobleaching and regeneration kinetics of Carassius auratus Rhodopsin, researchers should employ:

  • Time-resolved spectroscopy: Monitoring absorption changes at multiple wavelengths during light exposure and subsequent dark adaptation

  • Fluorescence-based assays: Tracking conformational changes using intrinsic tryptophan fluorescence or introduced fluorescent labels

  • Biochemical analysis of photointermediates: Using rapid quenching techniques combined with HPLC to isolate and characterize reaction intermediates

Experimental design must include careful control of light intensity, temperature, and pH, as these factors significantly influence photobleaching and regeneration rates. Comparative studies between recombinant proteins and native rhodopsin can validate that the recombinant system faithfully reproduces native properties .

How does research on fish rhodopsin contribute to understanding human retinal diseases?

Studies on Carassius auratus Rhodopsin provide valuable insights for understanding human retinal diseases, particularly those caused by rhodopsin mutations. Methodological approaches include:

  • Comparative structural analysis: Identifying conserved regions between fish and human rhodopsin that might be critical for function

  • Disease mutation modeling: Introducing equivalent mutations found in human retinitis pigmentosa into fish rhodopsin

  • Functional characterization: Assessing how these mutations affect protein folding, trafficking, chromophore binding, and G-protein activation

Mutations in RHO, the gene for human rhodopsin, account for a significant fraction of autosomal-dominant retinitis pigmentosa (adRP) . Research on fish rhodopsin can help develop therapeutic strategies at the DNA or RNA level or approaches to preserve photoreceptor viability .

Therapeutic ApproachMechanismResearch Application
Gene correctionTargeting mutant gene at DNA levelTesting in animal models before human trials
RNA modificationReplacing mutant RNADeveloping delivery methods for RNA therapeutics
Photoreceptor preservationMaintaining viable cells without addressing mutationDeveloping adjunct therapies for progressive disease

How does rhodopsin dimerization affect experimental design and interpretation?

Rhodopsin appears to function as a dimer or multimer in disc membranes, playing both structural and catalytic roles . This oligomerization property significantly impacts experimental design:

  • Purification strategies: Must consider the native oligomeric state when selecting detergents and buffer conditions

  • Functional assays: Should account for potential cooperative effects between rhodopsin molecules

  • Structural studies: Need to capture the protein in its native oligomeric arrangement

Researchers investigating dimerization should employ techniques such as chemical crosslinking, native gel electrophoresis, analytical ultracentrifugation, or single-molecule imaging to characterize oligomeric states. Understanding these interactions is critical as mutations that disrupt dimerization may contribute to photoreceptor degeneration mechanisms .

What are the methodological considerations for studying rhodopsin-G protein interactions?

When investigating rhodopsin-G protein interactions, researchers should consider:

  • Reconstitution systems: Purified components in defined lipid environments or nanodiscs provide controlled conditions

  • Real-time binding assays: FRET-based approaches or surface plasmon resonance can monitor interaction kinetics

  • Structural studies: Cryo-electron microscopy or X-ray crystallography of complexes reveal interaction interfaces

Experimental designs must account for the transient nature of these interactions and the conformational changes involved. Specific mutations can be introduced to stabilize particular states of the activation pathway, facilitating structural studies of otherwise short-lived intermediates .

How does research on visual opsins inform understanding of non-visual photoreception in fish?

Research on Carassius auratus visual opsins provides a foundation for understanding non-visual photoreception. A relevant example is vertebrate ancient long (VAL) opsin, a non-visual "photoreceptor" in the deep brain of goldfish that affects reproduction . Methodology for investigating these connections includes:

  • Comparative expression analysis: Examining tissue-specific expression patterns beyond the retina

  • Functional characterization: Testing responses to different wavelengths (e.g., green-wavelength light at 500, 520, and 540 nm)

  • Physiological measurements: Quantifying reproductive hormone responses to light and opsin stimulation

Research has shown that recombinant VAL-opsin injection (0.1 or 0.5 μg/g body mass) significantly increased gonadotropin hormone and estrogen receptor mRNA expression levels, as well as plasma FSH, LH, and 17β-estradiol activities in goldfish . This suggests a direct link between opsin function and reproductive physiology that extends beyond visual processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.